Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245623 677 bp mRNA linear INV 02-SEP-2023 (LOC106082882), mRNA. ACCESSION XM_013245623 VERSION XM_013245623.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245623.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..677 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..677 /gene="LOC106082882" /note="uncharacterized LOC106082882; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082882" CDS 21..650 /gene="LOC106082882" /codon_start=1 /product="uncharacterized protein LOC106082882" /protein_id="XP_013101077.2" /db_xref="GeneID:106082882" /translation="MAKFNINLAYSALLCVAVAVNLAQALNDGYDLAVINGYLNAYEK QVLTMNCMERSCDPLALQKIVEIENEVEKDLKARSTLFETHEIESVKVLRAIEATVGK MLLAVPECHDLSYSCPSKSGAIQTEPNFLSEYSTITHDIIKYGRSCVNLNNVQEAIKI LGDAVEYVEQENPNEPGNYFQRAMPARRFIANEYSKLCKGNPWVRHPIY" ORIGIN 1 aaaaaatcgt tcaatcagat atggcaaaat tcaacatcaa tttggcatac agtgctttgc 61 tctgcgttgc tgtcgctgta aatttggcac aggctctcaa tgatggatat gatttggcgg 121 tcatcaacgg ttatctcaat gcctatgaaa aacaagtttt gaccatgaac tgcatggaaa 181 gaagttgtga tcctttggct cttcagaaaa tagttgaaat cgagaatgaa gtggaaaaag 241 atttaaaagc tagatcaaca ttattcgaaa ctcacgaaat cgaatcggta aaggttctcc 301 gagcaattga agccacagtt gggaaaatgt tacttgccgt gcccgaatgc catgacctgt 361 cgtactcttg cccaagtaaa tccggtgcaa ttcaaacaga accaaatttc cttagcgaat 421 actcaacgat tacacatgat attatcaaat acggaagaag ctgcgtcaat ttgaacaacg 481 tacaagaagc cattaaaatc ttgggcgatg ctgtcgaata tgttgaacaa gaaaatccca 541 atgaacccgg caattacttc caaagagcta tgcctgctcg tcgctttatt gcaaatgaat 601 atagcaaatt gtgcaaaggc aacccttggg taaggcaccc aatttattaa atgaaaaatg 661 agctattgat atgctat