Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082882


LOCUS       XM_013245623             677 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082882), mRNA.
ACCESSION   XM_013245623
VERSION     XM_013245623.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245623.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..677
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..677
                     /gene="LOC106082882"
                     /note="uncharacterized LOC106082882; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082882"
     CDS             21..650
                     /gene="LOC106082882"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082882"
                     /protein_id="XP_013101077.2"
                     /db_xref="GeneID:106082882"
                     /translation="MAKFNINLAYSALLCVAVAVNLAQALNDGYDLAVINGYLNAYEK
                     QVLTMNCMERSCDPLALQKIVEIENEVEKDLKARSTLFETHEIESVKVLRAIEATVGK
                     MLLAVPECHDLSYSCPSKSGAIQTEPNFLSEYSTITHDIIKYGRSCVNLNNVQEAIKI
                     LGDAVEYVEQENPNEPGNYFQRAMPARRFIANEYSKLCKGNPWVRHPIY"
ORIGIN      
        1 aaaaaatcgt tcaatcagat atggcaaaat tcaacatcaa tttggcatac agtgctttgc
       61 tctgcgttgc tgtcgctgta aatttggcac aggctctcaa tgatggatat gatttggcgg
      121 tcatcaacgg ttatctcaat gcctatgaaa aacaagtttt gaccatgaac tgcatggaaa
      181 gaagttgtga tcctttggct cttcagaaaa tagttgaaat cgagaatgaa gtggaaaaag
      241 atttaaaagc tagatcaaca ttattcgaaa ctcacgaaat cgaatcggta aaggttctcc
      301 gagcaattga agccacagtt gggaaaatgt tacttgccgt gcccgaatgc catgacctgt
      361 cgtactcttg cccaagtaaa tccggtgcaa ttcaaacaga accaaatttc cttagcgaat
      421 actcaacgat tacacatgat attatcaaat acggaagaag ctgcgtcaat ttgaacaacg
      481 tacaagaagc cattaaaatc ttgggcgatg ctgtcgaata tgttgaacaa gaaaatccca
      541 atgaacccgg caattacttc caaagagcta tgcctgctcg tcgctttatt gcaaatgaat
      601 atagcaaatt gtgcaaaggc aacccttggg taaggcaccc aatttattaa atgaaaaatg
      661 agctattgat atgctat