Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans histone H3-like centromeric protein


LOCUS       XM_013245616             975 bp    mRNA    linear   INV 02-SEP-2023
            A (LOC106082877), mRNA.
ACCESSION   XM_013245616
VERSION     XM_013245616.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245616.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..975
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..975
                     /gene="LOC106082877"
                     /note="histone H3-like centromeric protein A; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106082877"
     CDS             44..613
                     /gene="LOC106082877"
                     /codon_start=1
                     /product="histone H3-like centromeric protein A"
                     /protein_id="XP_013101070.2"
                     /db_xref="GeneID:106082877"
                     /translation="MSPRKLSSTKRSAAIRRVGTLGDASVSESNISSPLELSPIQNPY
                     EILPTTSRAARARGELQFTLTNSTNRKERNTTSTPKSPVKGAARRKRKTPYQLQKANL
                     REIRKLQSSVDHQIPRVAFARVVREITMDFTTNVTHYTAVALQALQEATEMFLTQVFQ
                     DAYMLTMHRRAVTLSVSDMTLIRALKLQL"
     polyA_site      975
                     /gene="LOC106082877"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcaaaagcga cgctcaaatt taaactaaca aaatttattg aaaatgtcac ccagaaaatt
       61 atcgagcaca aaacgaagtg ccgctatcag aagagtagga acgttaggtg atgcatcagt
      121 cagtgaatcc aatatctcct cacctctaga attatcaccc atccagaacc catacgaaat
      181 cttgccaacc actagccggg cagctagagc tcgtggggag ctacagttca cactgaccaa
      241 ctctaccaat cggaaggaac gcaacacaac atcgactccc aaaagcccag taaaaggcgc
      301 agctcgtcgt aaacgcaaga ctccttatca acttcagaaa gccaatttaa gggaaatacg
      361 aaaattgcaa agttctgtgg atcatcaaat accaagagtt gcctttgcac gtgtagtgcg
      421 tgagattacc atggatttta caaccaatgt gacacactat acggcagtgg cactgcaagc
      481 gcttcaggag gcgacggaaa tgttcttaac tcaagtgttt caagatgctt acatgttgac
      541 gatgcataga agagctgtta cactatctgt gtccgatatg acattaatac gagctctgaa
      601 acttcaactc tagacatatt gtttcgtaaa gggggaactt tgtacatact cgatttttat
      661 ggatatgggt acatctattt gtcataatat tattttacag gaagttttag atatttttaa
      721 tatgcattta aatattgctt gaaataactc accaatttca agctaatatt taaacgtatt
      781 taaaaattat agggtatatt attaattgta cctaggcaca tatagtactt aggcattcgg
      841 atgcaatgaa tttttgattg tggtatatga taccatatac cataacacat aacttttact
      901 tactttaagt ttagtactta cgtcgttttg ttgttgttgt tattttatta caatgaacta
      961 tgtattgtat attct