Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans DDB1- and CUL4-associated factor 13


LOCUS       XM_013245606            1555 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082868), mRNA.
ACCESSION   XM_013245606
VERSION     XM_013245606.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245606.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1555
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1555
                     /gene="LOC106082868"
                     /note="DDB1- and CUL4-associated factor 13; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106082868"
     CDS             75..1412
                     /gene="LOC106082868"
                     /codon_start=1
                     /product="DDB1- and CUL4-associated factor 13"
                     /protein_id="XP_013101060.2"
                     /db_xref="GeneID:106082868"
                     /translation="MKVKMISRNPDDYVRETKNEHHKLPRNYDPALHPMESSREYVRA
                     LNATKLDRVFAKPFVGNLSGHRDGVSCFGKHPKQLSTLTSGAYDGEVRVWDLANRESV
                     RSFVAHEGFVRGICYDVTGERFFTVGDDKTIKVWNSSAPDVGEDEEPINTILSRTMIT
                     GITHHRKEPKYATCGEVCSIWDESRNDPLKNLKWGVDTLHAVAFNPVETSILACCGSD
                     RSIILYDQRAANPLRKMVLTMKSNKLAWNPMEAFNFSVANEDCNLYTFDTRQLKNPLK
                     IHFDHVSAVTDVDYSPTGKEIVSGSYDKTIRIYNVHQSHSRDIYHTKRMQHVVCVAWS
                     LDNRYVFTGSDEMNIRMWKAKASEKLGVIRPRERVAFNYQEALKEKYAAHPQIKRIAR
                     HRQVPRHVLNSQKKMRAVKDKELRKEANVRNHSKPGSVPFVAEKKKTVLKEEI"
     polyA_site      1555
                     /gene="LOC106082868"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttgtttaca aatacacgtg ccaaacgaac tgcgtaaaac tgaatttcgt ttaaacttta
       61 attttcttgc aaaaatgaag gtaaaaatga taagtcgtaa tccggatgat tatgtccgtg
      121 aaacgaaaaa cgagcaccat aaactacctc gcaattatga tcctgctttg catcccatgg
      181 aatcatcccg cgagtacgtt cgagccttaa atgccacaaa gttagacaga gtttttgcta
      241 aaccttttgt gggtaattta agtggtcacc gagatggggt ctcctgcttc ggcaagcatc
      301 ctaaacaatt gtcgactcta acgtctgggg catatgacgg cgaagtacgt gtctgggatt
      361 tggcgaatcg cgaaagtgta cgcagctttg tggcccacga aggctttgtt cgaggcattt
      421 gttacgatgt aaccggtgaa cgtttcttta cggtgggcga tgacaaaacc ataaaggtgt
      481 ggaattcctc ggcacctgac gtaggcgaag atgaagaacc aatcaacaca atattaagtc
      541 gcaccatgat cacaggcatt acacatcatc gcaaagaacc aaaatacgca acatgtggcg
      601 aagtctgttc gatttgggat gagagtagaa atgatccact caaaaattta aaatggggtg
      661 ttgacactct gcatgcggtg gcctttaatc cggtggaaac ttccatattg gcatgttgtg
      721 gaagtgaccg ttccattatc ttgtatgacc aacgcgcagc caacccccta aggaaaatgg
      781 tattgaccat gaagagtaac aaattggcat ggaatcccat ggaagctttc aatttcagtg
      841 tggcaaacga agactgcaat ctctatactt ttgataccag acagctgaag aatcctctaa
      901 aaatccattt cgaccatgtg tcagcagtca ccgatgtaga ctattcaccc actggcaagg
      961 aaattgtttc cggcagttac gataagacaa ttcgcattta caacgttcac cagagtcatt
     1021 cgcgtgatat ttatcacacc aaacgaatgc aacatgtcgt ttgtgtggcc tggtccttgg
     1081 acaatcgtta tgtgtttact ggatccgatg aaatgaatat ccgtatgtgg aaggctaaag
     1141 cttctgaaaa attgggtgtt atacgtcctc gtgaacgtgt tgccttcaac tatcaggagg
     1201 cattaaagga gaaatatgca gcacatccac aaatcaaacg tattgccaga catcgtcaag
     1261 tgccacgtca cgtattgaat tcgcaaaaga aaatgcgagc tgtcaaggac aaggagttac
     1321 gcaaggaagc caatgtacga aatcattcga aaccgggctc agtgccattt gtggctgaga
     1381 agaagaagac tgtactgaag gaggaaattt agaatagctt tgattcaaat atgctttagt
     1441 taaataggat ataaattgtt ttaaaaaata aaccattttc tttttgtata aaccactagt
     1501 gcgtggctgt gaatgaccga ccactaataa aggaccactg tcgagcatga cttta