PREDICTED: Stomoxys calcitrans uncharacterized LOC106082866

LOCUS       XM_013245602             648 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082866), mRNA.
ACCESSION   XM_013245602
VERSION     XM_013245602.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245602.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 40% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..648
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..648
                     /gene="LOC106082866"
                     /note="uncharacterized LOC106082866; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082866"
     CDS             46..648
                     /gene="LOC106082866"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082866"
                     /protein_id="XP_013101056.2"
                     /db_xref="GeneID:106082866"
                     /translation="MLSSQMSWVFGALLLFAVANLTQAVNERHDLSVITDLIDMMVEQ
                     LEILKCMTRSCDPLALEKMIEIEDGVERDLKAQSSLPETHEYESEKVDKAIKLSVAKY
                     LEVEPKCQDTSYSCPNPILKELPKYFTDYVNAVQEIIMYGRKCVNLNNIEQAINVLGE
                     SVELVEGYHNHAGNYMQRVLPSCVHCSNGFRQLCDEAAIN"
ORIGIN      
        1 cagttatttt cagtttgggc aaaataaaaa ttcttcaaac ctcaaatgtt aagttcccaa
       61 atgtcttggg tttttggcgc tttgcttttg tttgctgtcg caaatttaac gcaagctgtc
      121 aacgagcgcc atgacttgag tgtgatcaca gaccttatcg atatgatggt agagcaattg
      181 gaaatactaa aatgtatgac aagaagttgt gatcctttgg cccttgagaa aatgattgaa
      241 attgaggatg gtgtagaaag ggatcttaag gctcaatcgt cccttccgga aacccatgaa
      301 tacgaatcag agaaagtgga taaagctatt aaactatcag tggccaagta tttggaagtt
      361 gaacccaaat gtcaagatac cagctacagt tgtcccaatc ccatattaaa ggaactccca
      421 aaatatttca ctgactatgt taacgctgta caggaaatta taatgtatgg ccgaaaatgt
      481 gtcaatttga ataatatcga gcaagccata aatgtcttgg gcgaaagcgt tgaattggtg
      541 gaaggatatc acaaccacgc cggaaactat atgcaacgcg ttttaccctc ttgcgttcat
      601 tgctctaatg gttttaggca attgtgtgat gaagctgcaa taaattga