Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245526 1983 bp mRNA linear INV 02-SEP-2023 (LOC106082790), mRNA. ACCESSION XM_013245526 VERSION XM_013245526.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; corrected model. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245526.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-251 OY720438.1 5001748-5001998 252-491 OY720438.1 5002000-5002239 492-1983 OY720438.1 5003895-5005386 FEATURES Location/Qualifiers source 1..1983 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1983 /gene="LOC106082790" /note="uncharacterized LOC106082790; The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106082790" CDS 99..1817 /gene="LOC106082790" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: uncharacterized protein LOC106082790" /protein_id="XP_013100980.2" /db_xref="GeneID:106082790" /translation="MTAVAASLNVSSELDITPSRKRKRQFERVQEKAAAPTIKSCFTN EAFHSTPKKIIAKRRLNKENVTQIYGLEVKSIAEIANEDNESKQQEQPLNPYEVVRPP KKKQKPAPACFENPALNLNGPDKQFNPYEIVREPTPLTNSNCFVNSALNLKTNDEVPA SRNPFEIQRDSMPVMPSKLKIGLPFVPNIGCRIDFKDMSMTQLTPSKLLAEKLVFSPV VKHKVSLGSIGEETMDIGKELDCYQLELENSINEAKLRKNGGMENLEIATPPLKETYE INVEQKINIKHKLTEIKEDVENEIVEESVVETYQHSEVQAICETRKQEETEEILDNKN PFVNTADTSPEKQPSGEGTAKCNNPFVYTEEEDIATNPEILDELYGPDSDVEGADVSF DFKTPAPFVRAYTRAASPKLRVSRESLKKEEGSDKQAEEGDHIRKSLNVKNMIRKSIR KLMHPHGFAQKHEQGEEQEGDKHGVGFINTIRQSLRRKPARHLLEEEEHSPVNECELS IVDGSERTLKLKSNLPQTDYVKIEDLTNEKKHNLRNSIRRSTREVGHQFMKTVFHKKH EEYEFR" ORIGIN 1 taattttgaa ggacaattat tcatcagctt ggtttagtta attatttggt gaaattttga 61 tttatctggt gttagattcg aaaaattttc taaaaaaaat gaccgcagtt gccgccagtt 121 taaatgtttc ctcagaacta gatatcacac cgtccagaaa acgtaaacgc caatttgaac 181 gcgtccaaga aaaggcagct gcacctacaa ttaagtcttg ttttaccaat gaagcatttc 241 attctacacc aaagaaaatt attgccaaaa ggcgtctcaa taaggagaat gtaacacaaa 301 tatatggttt ggaggtcaaa tcgatagcgg aaatagccaa cgaagataac gagagtaaac 361 agcaggaaca accattaaat ccatatgaag ttgtaaggcc accaaagaaa aagcaaaaac 421 cagctccagc ttgctttgag aacccagcgc ttaatttgaa tgggccggac aagcaattca 481 acccttatga gattgttcga gaaccgactc ctttgaccaa ttccaattgc tttgttaatt 541 cagccttaaa tttaaaaacc aatgatgagg tgccagcttc tcgcaatccc tttgaaatac 601 aaagggattc catgccagtt atgccaagta aattgaagat tggtttaccc tttgttccca 661 atatagggtg tcgcattgac tttaaggaca tgtcgatgac acaactcaca ccatctaagc 721 tgctggccga aaagttggta ttttctcctg tggttaagca taaagtctca ttgggttcta 781 ttggtgaaga gacaatggat ataggaaaag aattggattg ttaccaactg gaattggaga 841 atagcattaa cgaggccaag ttgcgtaaaa atggaggaat ggaaaacttg gaaattgcta 901 ctcctccact gaaagaaact tatgaaataa atgtggaaca aaaaattaac attaaacata 961 agctaacgga aataaaggaa gacgtggaga atgaaatcgt cgaggagtct gtagtcgaga 1021 catatcaaca ttctgaagtc caggcaattt gtgaaactag aaagcaagaa gagaccgagg 1081 aaatcctaga taacaaaaat ccgtttgtga atacagcaga tacaagccca gagaaacaac 1141 cctcaggcga aggcactgct aaatgcaata acccttttgt ttataccgag gaagaagata 1201 ttgccacaaa ccctgaaatt ttagacgagc tctatggtcc cgacagtgat gtcgagggtg 1261 cagatgtctc ttttgatttt aagacaccag caccctttgt aagggcctat accagagcag 1321 catccccgaa attaagagta agtcgtgaat cactaaagaa ggaggaaggt agtgataaac 1381 aagccgagga gggtgatcac attagaaaat ctttgaatgt gaaaaatatg atacgcaaat 1441 ctatacgaaa gctaatgcat ccccatggct ttgcacaaaa acatgagcaa ggcgaggagc 1501 aggaaggaga taaacatggt gttggcttta ttaataccat acggcaaagt ctgcgtcgca 1561 aacctgccag gcatctacta gaggaggagg agcattcacc ggttaacgaa tgcgaactgt 1621 ccattgtgga tggcagcgaa agaaccctaa agctgaaatc gaatctgcca cagaccgact 1681 atgtgaaaat cgaggatcta accaatgaaa agaagcacaa tctacgcaac agcatcaggc 1741 gttccactcg ggaagtgggc catcagttca tgaagaccgt gtttcacaag aaacacgagg 1801 agtatgaatt taggtaattt tgtttatttt gcaaaaaaat attgaaattt gttaattatt 1861 ccaaagattt ttttctcaat tatagcctag ttataataat ccttaagttt actttcgttt 1921 tctcttacta ttgcacattt atgaacttga acttattcct aagtatgtaa ttacatgtta 1981 cat