Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082790


LOCUS       XM_013245526            1983 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082790), mRNA.
ACCESSION   XM_013245526
VERSION     XM_013245526.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; corrected model.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245526.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-251               OY720438.1         5001748-5001998
            252-491             OY720438.1         5002000-5002239
            492-1983            OY720438.1         5003895-5005386
FEATURES             Location/Qualifiers
     source          1..1983
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1983
                     /gene="LOC106082790"
                     /note="uncharacterized LOC106082790; The sequence of the
                     model RefSeq transcript was modified relative to its
                     source genomic sequence to represent the inferred CDS:
                     deleted 1 base in 1 codon; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106082790"
     CDS             99..1817
                     /gene="LOC106082790"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein
                     LOC106082790"
                     /protein_id="XP_013100980.2"
                     /db_xref="GeneID:106082790"
                     /translation="MTAVAASLNVSSELDITPSRKRKRQFERVQEKAAAPTIKSCFTN
                     EAFHSTPKKIIAKRRLNKENVTQIYGLEVKSIAEIANEDNESKQQEQPLNPYEVVRPP
                     KKKQKPAPACFENPALNLNGPDKQFNPYEIVREPTPLTNSNCFVNSALNLKTNDEVPA
                     SRNPFEIQRDSMPVMPSKLKIGLPFVPNIGCRIDFKDMSMTQLTPSKLLAEKLVFSPV
                     VKHKVSLGSIGEETMDIGKELDCYQLELENSINEAKLRKNGGMENLEIATPPLKETYE
                     INVEQKINIKHKLTEIKEDVENEIVEESVVETYQHSEVQAICETRKQEETEEILDNKN
                     PFVNTADTSPEKQPSGEGTAKCNNPFVYTEEEDIATNPEILDELYGPDSDVEGADVSF
                     DFKTPAPFVRAYTRAASPKLRVSRESLKKEEGSDKQAEEGDHIRKSLNVKNMIRKSIR
                     KLMHPHGFAQKHEQGEEQEGDKHGVGFINTIRQSLRRKPARHLLEEEEHSPVNECELS
                     IVDGSERTLKLKSNLPQTDYVKIEDLTNEKKHNLRNSIRRSTREVGHQFMKTVFHKKH
                     EEYEFR"
ORIGIN      
        1 taattttgaa ggacaattat tcatcagctt ggtttagtta attatttggt gaaattttga
       61 tttatctggt gttagattcg aaaaattttc taaaaaaaat gaccgcagtt gccgccagtt
      121 taaatgtttc ctcagaacta gatatcacac cgtccagaaa acgtaaacgc caatttgaac
      181 gcgtccaaga aaaggcagct gcacctacaa ttaagtcttg ttttaccaat gaagcatttc
      241 attctacacc aaagaaaatt attgccaaaa ggcgtctcaa taaggagaat gtaacacaaa
      301 tatatggttt ggaggtcaaa tcgatagcgg aaatagccaa cgaagataac gagagtaaac
      361 agcaggaaca accattaaat ccatatgaag ttgtaaggcc accaaagaaa aagcaaaaac
      421 cagctccagc ttgctttgag aacccagcgc ttaatttgaa tgggccggac aagcaattca
      481 acccttatga gattgttcga gaaccgactc ctttgaccaa ttccaattgc tttgttaatt
      541 cagccttaaa tttaaaaacc aatgatgagg tgccagcttc tcgcaatccc tttgaaatac
      601 aaagggattc catgccagtt atgccaagta aattgaagat tggtttaccc tttgttccca
      661 atatagggtg tcgcattgac tttaaggaca tgtcgatgac acaactcaca ccatctaagc
      721 tgctggccga aaagttggta ttttctcctg tggttaagca taaagtctca ttgggttcta
      781 ttggtgaaga gacaatggat ataggaaaag aattggattg ttaccaactg gaattggaga
      841 atagcattaa cgaggccaag ttgcgtaaaa atggaggaat ggaaaacttg gaaattgcta
      901 ctcctccact gaaagaaact tatgaaataa atgtggaaca aaaaattaac attaaacata
      961 agctaacgga aataaaggaa gacgtggaga atgaaatcgt cgaggagtct gtagtcgaga
     1021 catatcaaca ttctgaagtc caggcaattt gtgaaactag aaagcaagaa gagaccgagg
     1081 aaatcctaga taacaaaaat ccgtttgtga atacagcaga tacaagccca gagaaacaac
     1141 cctcaggcga aggcactgct aaatgcaata acccttttgt ttataccgag gaagaagata
     1201 ttgccacaaa ccctgaaatt ttagacgagc tctatggtcc cgacagtgat gtcgagggtg
     1261 cagatgtctc ttttgatttt aagacaccag caccctttgt aagggcctat accagagcag
     1321 catccccgaa attaagagta agtcgtgaat cactaaagaa ggaggaaggt agtgataaac
     1381 aagccgagga gggtgatcac attagaaaat ctttgaatgt gaaaaatatg atacgcaaat
     1441 ctatacgaaa gctaatgcat ccccatggct ttgcacaaaa acatgagcaa ggcgaggagc
     1501 aggaaggaga taaacatggt gttggcttta ttaataccat acggcaaagt ctgcgtcgca
     1561 aacctgccag gcatctacta gaggaggagg agcattcacc ggttaacgaa tgcgaactgt
     1621 ccattgtgga tggcagcgaa agaaccctaa agctgaaatc gaatctgcca cagaccgact
     1681 atgtgaaaat cgaggatcta accaatgaaa agaagcacaa tctacgcaac agcatcaggc
     1741 gttccactcg ggaagtgggc catcagttca tgaagaccgt gtttcacaag aaacacgagg
     1801 agtatgaatt taggtaattt tgtttatttt gcaaaaaaat attgaaattt gttaattatt
     1861 ccaaagattt ttttctcaat tatagcctag ttataataat ccttaagttt actttcgttt
     1921 tctcttacta ttgcacattt atgaacttga acttattcct aagtatgtaa ttacatgtta
     1981 cat