Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245352 821 bp mRNA linear INV 02-SEP-2023 (LOC106082688), mRNA. ACCESSION XM_013245352 VERSION XM_013245352.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245352.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..821 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..821 /gene="LOC106082688" /note="uncharacterized LOC106082688; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106082688" CDS 28..639 /gene="LOC106082688" /codon_start=1 /product="uncharacterized protein LOC106082688" /protein_id="XP_013100806.2" /db_xref="GeneID:106082688" /translation="MSFVTPQTPTKNKPSSSQAQSTVSSAPQHNLDDINMLLYLDALK RKVDNENAITQKIEEAYKTYQKRRLEYIHLYSKYTDLVKKALTRRALNGRLTPIDLST ASADMRSIKEKLSSGIATDYIEKQELEKFKLFLGSDGNHDNLEKLRLEMMELKIATKS IQATIEATEAALDNGTNQGLDLFANELDMENFPNLAELYDTES" polyA_site 821 /gene="LOC106082688" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taagacatac aaacaaataa acgaaaaatg tcttttgtta cgccacaaac cccaactaag 61 aataagccaa gttcgtctca agcacagagc accgtttcat cagccccaca acacaacctt 121 gatgatatta acatgctttt gtacctggat gccttgaagc gaaaagtgga caatgagaac 181 gccattactc aaaaaattga agaagcctac aagacatatc aaaagcggcg attggaatac 241 attcatctat attcaaaata tacagattta gttaaaaaag cccttacacg aagagctttg 301 aatgggcggc taactccaat tgatctatca acagcctcgg cagacatgcg aagtattaag 361 gaaaaactga gcagtggtat tgccaccgat tacatcgaaa aacaggaatt ggaaaagttt 421 aaattattcc taggctcaga tggcaatcac gataatttgg aaaaacttcg tcttgaaatg 481 atggaactaa aaatagccac aaaatccata caagccacga ttgaggcaac agaggcagct 541 ttagacaatg gaacaaatca agggctggat ctctttgcca atgagttgga tatggaaaat 601 ttcccaaact tagcggaatt gtatgatacg gaaagttaaa caagctttca catgggtttc 661 ttctatagtt tttattttta ttcacgaaca aagggatctg gtgaatggag gacatgtcgc 721 cgttctagca tatgtgcact agttcttttg tgtgtgatga aaggggaatg tcgatttgtt 781 ttctatacaa taagaaataa aaaaattatg agttattcta a