Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription factor MafK


LOCUS       XM_013245346             676 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082681), transcript variant X5, mRNA.
ACCESSION   XM_013245346
VERSION     XM_013245346.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245346.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..676
                     /gene="LOC106082681"
                     /note="transcription factor MafK; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106082681"
     CDS             96..464
                     /gene="LOC106082681"
                     /codon_start=1
                     /product="transcription factor MafK isoform X4"
                     /protein_id="XP_013100800.1"
                     /db_xref="GeneID:106082681"
                     /translation="MAPLSPCPIPDISDDELVSISVRDLNRTLKMRGLNREEIVRMKQ
                     RRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELEQMHEENEHCSREIENWKKKYN
                     ALLQFAAHNDIPIPPELEGC"
     misc_feature    201..410
                     /gene="LOC106082681"
                     /note="Basic leucine zipper (bZIP) domain of small
                     musculoaponeurotic fibrosarcoma (Maf) proteins: a
                     DNA-binding and dimerization domain; Region:
                     bZIP_Maf_small; cd14717"
                     /db_xref="CDD:269865"
     misc_feature    201..410
                     /gene="LOC106082681"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269865"
     misc_feature    order(231..239,243..251,255..260,267..272,276..281)
                     /gene="LOC106082681"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:269865"
     misc_feature    order(279..281,288..293,300..305,309..314,321..326,
                     330..335,342..344,351..356,363..365,372..377,384..389)
                     /gene="LOC106082681"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:269865"
     polyA_site      676
                     /gene="LOC106082681"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acatcatatt gtgtccagct gtcattgtgt ggtgctagtt ttcgttaatt tctctataaa
       61 gctttacgtc aaggagtcgc aatataaaat caacaatggc acccttatca ccatgtccca
      121 ttccggatat tagtgatgat gaattggttt ccatttctgt gcgagattta aatcgcactc
      181 ttaaaatgcg aggtcttaat cgcgaagaaa ttgtacgtat gaaacaacga cgtcgtactc
      241 ttaagaatcg tggctatgct gctagttgtc gcattaagcg catagagcaa aaagatgttt
      301 tggaaactga aaaatcgcac gaatggattg aattggagca aatgcatgag gaaaacgaac
      361 actgtagtcg agagattgaa aattggaaaa agaaatataa tgctctgtta cagtttgcag
      421 ctcacaatga tatacccata ccgccagaat tagagggctg ctaagatggg gggtaatgca
      481 tttagccttg gtatattcct tggttttttt gtagtgatat gatgtagaag agtgatttca
      541 gtacaatttt attcctttca ctaaatattt tactttctaa gattgttttt agatttaaga
      601 gaaacttgat atagatattt ttaaattaag ctttatgtat aatacatttg tatgtatacg
      661 aatattataa aaccaa