Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245346 676 bp mRNA linear INV 02-SEP-2023 (LOC106082681), transcript variant X5, mRNA. ACCESSION XM_013245346 VERSION XM_013245346.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245346.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..676 /gene="LOC106082681" /note="transcription factor MafK; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106082681" CDS 96..464 /gene="LOC106082681" /codon_start=1 /product="transcription factor MafK isoform X4" /protein_id="XP_013100800.1" /db_xref="GeneID:106082681" /translation="MAPLSPCPIPDISDDELVSISVRDLNRTLKMRGLNREEIVRMKQ RRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELEQMHEENEHCSREIENWKKKYN ALLQFAAHNDIPIPPELEGC" misc_feature 201..410 /gene="LOC106082681" /note="Basic leucine zipper (bZIP) domain of small musculoaponeurotic fibrosarcoma (Maf) proteins: a DNA-binding and dimerization domain; Region: bZIP_Maf_small; cd14717" /db_xref="CDD:269865" misc_feature 201..410 /gene="LOC106082681" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:269865" misc_feature order(231..239,243..251,255..260,267..272,276..281) /gene="LOC106082681" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:269865" misc_feature order(279..281,288..293,300..305,309..314,321..326, 330..335,342..344,351..356,363..365,372..377,384..389) /gene="LOC106082681" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:269865" polyA_site 676 /gene="LOC106082681" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acatcatatt gtgtccagct gtcattgtgt ggtgctagtt ttcgttaatt tctctataaa 61 gctttacgtc aaggagtcgc aatataaaat caacaatggc acccttatca ccatgtccca 121 ttccggatat tagtgatgat gaattggttt ccatttctgt gcgagattta aatcgcactc 181 ttaaaatgcg aggtcttaat cgcgaagaaa ttgtacgtat gaaacaacga cgtcgtactc 241 ttaagaatcg tggctatgct gctagttgtc gcattaagcg catagagcaa aaagatgttt 301 tggaaactga aaaatcgcac gaatggattg aattggagca aatgcatgag gaaaacgaac 361 actgtagtcg agagattgaa aattggaaaa agaaatataa tgctctgtta cagtttgcag 421 ctcacaatga tatacccata ccgccagaat tagagggctg ctaagatggg gggtaatgca 481 tttagccttg gtatattcct tggttttttt gtagtgatat gatgtagaag agtgatttca 541 gtacaatttt attcctttca ctaaatattt tactttctaa gattgttttt agatttaaga 601 gaaacttgat atagatattt ttaaattaag ctttatgtat aatacatttg tatgtatacg 661 aatattataa aaccaa