Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082682


LOCUS       XM_013245345             714 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082682), mRNA.
ACCESSION   XM_013245345
VERSION     XM_013245345.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245345.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..714
                     /gene="LOC106082682"
                     /note="uncharacterized LOC106082682; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082682"
     CDS             20..640
                     /gene="LOC106082682"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082682"
                     /protein_id="XP_013100799.2"
                     /db_xref="GeneID:106082682"
                     /translation="MANLRSAFHVNNENHGQGVVHSSKNESARKHSAKKAVFGELKNV
                     IHNQYKPKSLNYGDGATNKQPMQSFVKRTKTEVRQQNVAKPKRLEVIKESKDDEIEML
                     KYFDFAPICCSKRPKSDRQIWAEMDMFNDSMLDQSIFKDEEIQEVQEVENFYFDDSGV
                     DIDFNASKIFNVTLPTIDSDEEDFLPKPPFVMRPLTPCELPDLGDI"
     polyA_site      714
                     /gene="LOC106082682"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acacagcata gacgagaaaa tggctaattt acgaagcgct ttccacgtta ataacgaaaa
       61 ccatggtcaa ggcgttgttc attcgtctaa aaatgaatcg gctcgcaagc attcggcaaa
      121 aaaggctgtt tttggagagc ttaaaaatgt tatccataat cagtataagc ccaaatcttt
      181 gaactatggc gatggagcga ccaacaaaca acccatgcaa agttttgtta aaaggacgaa
      241 aacagaagtt cgccaacaaa atgtggctaa gcccaaacgt ctggaggtga ttaaggaaag
      301 caaagacgat gaaatagaaa tgttgaaata ttttgatttt gccccaattt gctgttctaa
      361 gcgtcccaaa agtgatcgcc aaatttgggc cgaaatggat atgtttaatg attcaatgct
      421 tgaccaaagc attttcaagg atgaagaaat acaggaagta caagaagtcg aaaactttta
      481 ttttgacgac tctggggtcg atatcgattt taatgcatcc aagatattca atgttacatt
      541 accaacaatt gactcagacg aagaagattt cttgcccaag ccgccatttg taatgcgtcc
      601 cctgacacca tgcgagttgc ctgatttggg ggatatttaa ggctaattat gtattttttt
      661 attttgtttg tactccctta tccattttat tattaaaacc tatattttat ttaa