Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245345 714 bp mRNA linear INV 02-SEP-2023 (LOC106082682), mRNA. ACCESSION XM_013245345 VERSION XM_013245345.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245345.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..714 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..714 /gene="LOC106082682" /note="uncharacterized LOC106082682; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082682" CDS 20..640 /gene="LOC106082682" /codon_start=1 /product="uncharacterized protein LOC106082682" /protein_id="XP_013100799.2" /db_xref="GeneID:106082682" /translation="MANLRSAFHVNNENHGQGVVHSSKNESARKHSAKKAVFGELKNV IHNQYKPKSLNYGDGATNKQPMQSFVKRTKTEVRQQNVAKPKRLEVIKESKDDEIEML KYFDFAPICCSKRPKSDRQIWAEMDMFNDSMLDQSIFKDEEIQEVQEVENFYFDDSGV DIDFNASKIFNVTLPTIDSDEEDFLPKPPFVMRPLTPCELPDLGDI" polyA_site 714 /gene="LOC106082682" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acacagcata gacgagaaaa tggctaattt acgaagcgct ttccacgtta ataacgaaaa 61 ccatggtcaa ggcgttgttc attcgtctaa aaatgaatcg gctcgcaagc attcggcaaa 121 aaaggctgtt tttggagagc ttaaaaatgt tatccataat cagtataagc ccaaatcttt 181 gaactatggc gatggagcga ccaacaaaca acccatgcaa agttttgtta aaaggacgaa 241 aacagaagtt cgccaacaaa atgtggctaa gcccaaacgt ctggaggtga ttaaggaaag 301 caaagacgat gaaatagaaa tgttgaaata ttttgatttt gccccaattt gctgttctaa 361 gcgtcccaaa agtgatcgcc aaatttgggc cgaaatggat atgtttaatg attcaatgct 421 tgaccaaagc attttcaagg atgaagaaat acaggaagta caagaagtcg aaaactttta 481 ttttgacgac tctggggtcg atatcgattt taatgcatcc aagatattca atgttacatt 541 accaacaatt gactcagacg aagaagattt cttgcccaag ccgccatttg taatgcgtcc 601 cctgacacca tgcgagttgc ctgatttggg ggatatttaa ggctaattat gtattttttt 661 attttgtttg tactccctta tccattttat tattaaaacc tatattttat ttaa