Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245344 683 bp mRNA linear INV 02-SEP-2023 (LOC106082681), transcript variant X4, mRNA. ACCESSION XM_013245344 VERSION XM_013245344.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245344.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..683 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..683 /gene="LOC106082681" /note="transcription factor MafK; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106082681" CDS 85..471 /gene="LOC106082681" /codon_start=1 /product="transcription factor MafK isoform X3" /protein_id="XP_013100798.1" /db_xref="GeneID:106082681" /translation="MVTDDLYAPLSPCPIPDISDDELVSISVRDLNRTLKMRGLNREE IVRMKQRRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELEQMHEENEHCSREIEN WKKKYNALLQFAAHNDIPIPPELEGC" misc_feature 208..417 /gene="LOC106082681" /note="Basic leucine zipper (bZIP) domain of small musculoaponeurotic fibrosarcoma (Maf) proteins: a DNA-binding and dimerization domain; Region: bZIP_Maf_small; cd14717" /db_xref="CDD:269865" misc_feature 208..417 /gene="LOC106082681" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:269865" misc_feature order(238..246,250..258,262..267,274..279,283..288) /gene="LOC106082681" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:269865" misc_feature order(286..288,295..300,307..312,316..321,328..333, 337..342,349..351,358..363,370..372,379..384,391..396) /gene="LOC106082681" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:269865" polyA_site 683 /gene="LOC106082681" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtccagctg tcattgtgtg gtgctagttt tcgttaattt ctctataaag ctttacgtca 61 aggagtcgca atataaaatc aacaatggta actgatgatc tttatgcacc cttatcacca 121 tgtcccattc cggatattag tgatgatgaa ttggtttcca tttctgtgcg agatttaaat 181 cgcactctta aaatgcgagg tcttaatcgc gaagaaattg tacgtatgaa acaacgacgt 241 cgtactctta agaatcgtgg ctatgctgct agttgtcgca ttaagcgcat agagcaaaaa 301 gatgttttgg aaactgaaaa atcgcacgaa tggattgaat tggagcaaat gcatgaggaa 361 aacgaacact gtagtcgaga gattgaaaat tggaaaaaga aatataatgc tctgttacag 421 tttgcagctc acaatgatat acccataccg ccagaattag agggctgcta agatgggggg 481 taatgcattt agccttggta tattccttgg tttttttgta gtgatatgat gtagaagagt 541 gatttcagta caattttatt cctttcacta aatattttac tttctaagat tgtttttaga 601 tttaagagaa acttgatata gatattttta aattaagctt tatgtataat acatttgtat 661 gtatacgaat attataaaac caa