Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription factor MafK


LOCUS       XM_013245344             683 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082681), transcript variant X4, mRNA.
ACCESSION   XM_013245344
VERSION     XM_013245344.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245344.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..683
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..683
                     /gene="LOC106082681"
                     /note="transcription factor MafK; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106082681"
     CDS             85..471
                     /gene="LOC106082681"
                     /codon_start=1
                     /product="transcription factor MafK isoform X3"
                     /protein_id="XP_013100798.1"
                     /db_xref="GeneID:106082681"
                     /translation="MVTDDLYAPLSPCPIPDISDDELVSISVRDLNRTLKMRGLNREE
                     IVRMKQRRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELEQMHEENEHCSREIEN
                     WKKKYNALLQFAAHNDIPIPPELEGC"
     misc_feature    208..417
                     /gene="LOC106082681"
                     /note="Basic leucine zipper (bZIP) domain of small
                     musculoaponeurotic fibrosarcoma (Maf) proteins: a
                     DNA-binding and dimerization domain; Region:
                     bZIP_Maf_small; cd14717"
                     /db_xref="CDD:269865"
     misc_feature    208..417
                     /gene="LOC106082681"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269865"
     misc_feature    order(238..246,250..258,262..267,274..279,283..288)
                     /gene="LOC106082681"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:269865"
     misc_feature    order(286..288,295..300,307..312,316..321,328..333,
                     337..342,349..351,358..363,370..372,379..384,391..396)
                     /gene="LOC106082681"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:269865"
     polyA_site      683
                     /gene="LOC106082681"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtccagctg tcattgtgtg gtgctagttt tcgttaattt ctctataaag ctttacgtca
       61 aggagtcgca atataaaatc aacaatggta actgatgatc tttatgcacc cttatcacca
      121 tgtcccattc cggatattag tgatgatgaa ttggtttcca tttctgtgcg agatttaaat
      181 cgcactctta aaatgcgagg tcttaatcgc gaagaaattg tacgtatgaa acaacgacgt
      241 cgtactctta agaatcgtgg ctatgctgct agttgtcgca ttaagcgcat agagcaaaaa
      301 gatgttttgg aaactgaaaa atcgcacgaa tggattgaat tggagcaaat gcatgaggaa
      361 aacgaacact gtagtcgaga gattgaaaat tggaaaaaga aatataatgc tctgttacag
      421 tttgcagctc acaatgatat acccataccg ccagaattag agggctgcta agatgggggg
      481 taatgcattt agccttggta tattccttgg tttttttgta gtgatatgat gtagaagagt
      541 gatttcagta caattttatt cctttcacta aatattttac tttctaagat tgtttttaga
      601 tttaagagaa acttgatata gatattttta aattaagctt tatgtataat acatttgtat
      661 gtatacgaat attataaaac caa