Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245342 797 bp mRNA linear INV 02-SEP-2023 (LOC106082681), transcript variant X3, mRNA. ACCESSION XM_013245342 VERSION XM_013245342.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245342.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..797 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..797 /gene="LOC106082681" /note="transcription factor MafK; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106082681" CDS 172..585 /gene="LOC106082681" /codon_start=1 /product="transcription factor MafK isoform X2" /protein_id="XP_013100796.1" /db_xref="GeneID:106082681" /translation="MDPLQQSRSRNIKSTMAPLSPCPIPDISDDELVSISVRDLNRTL KMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELEQMHEEN EHCSREIENWKKKYNALLQFAAHNDIPIPPELEGC" misc_feature 322..531 /gene="LOC106082681" /note="Basic leucine zipper (bZIP) domain of small musculoaponeurotic fibrosarcoma (Maf) proteins: a DNA-binding and dimerization domain; Region: bZIP_Maf_small; cd14717" /db_xref="CDD:269865" misc_feature 322..531 /gene="LOC106082681" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:269865" misc_feature order(352..360,364..372,376..381,388..393,397..402) /gene="LOC106082681" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:269865" misc_feature order(400..402,409..414,421..426,430..435,442..447, 451..456,463..465,472..477,484..486,493..498,505..510) /gene="LOC106082681" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:269865" polyA_site 797 /gene="LOC106082681" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgtgtcca gctgtcattg tgtggtgcta gttttcgtta atttctctat aaagctttac 61 ggatagaaga ttaattacta ttaatctctt ttcaaccaaa caacaacgca taaacttgga 121 aaaaatctta tctttaataa cttgcaaaaa caacaactat aattgcctta aatggatcca 181 ttacaacagt caaggagtcg caatataaaa tcaacaatgg cacccttatc accatgtccc 241 attccggata ttagtgatga tgaattggtt tccatttctg tgcgagattt aaatcgcact 301 cttaaaatgc gaggtcttaa tcgcgaagaa attgtacgta tgaaacaacg acgtcgtact 361 cttaagaatc gtggctatgc tgctagttgt cgcattaagc gcatagagca aaaagatgtt 421 ttggaaactg aaaaatcgca cgaatggatt gaattggagc aaatgcatga ggaaaacgaa 481 cactgtagtc gagagattga aaattggaaa aagaaatata atgctctgtt acagtttgca 541 gctcacaatg atatacccat accgccagaa ttagagggct gctaagatgg ggggtaatgc 601 atttagcctt ggtatattcc ttggtttttt tgtagtgata tgatgtagaa gagtgatttc 661 agtacaattt tattcctttc actaaatatt ttactttcta agattgtttt tagatttaag 721 agaaacttga tatagatatt tttaaattaa gctttatgta taatacattt gtatgtatac 781 gaatattata aaaccaa