Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription factor MafK


LOCUS       XM_013245341             803 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082681), transcript variant X2, mRNA.
ACCESSION   XM_013245341
VERSION     XM_013245341.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245341.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..803
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..803
                     /gene="LOC106082681"
                     /note="transcription factor MafK; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:106082681"
     CDS             160..591
                     /gene="LOC106082681"
                     /codon_start=1
                     /product="transcription factor MafK isoform X1"
                     /protein_id="XP_013100795.1"
                     /db_xref="GeneID:106082681"
                     /translation="MDPLQQSRSRNIKSTMVTDDLYAPLSPCPIPDISDDELVSISVR
                     DLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELE
                     QMHEENEHCSREIENWKKKYNALLQFAAHNDIPIPPELEGC"
     misc_feature    328..537
                     /gene="LOC106082681"
                     /note="Basic leucine zipper (bZIP) domain of small
                     musculoaponeurotic fibrosarcoma (Maf) proteins: a
                     DNA-binding and dimerization domain; Region:
                     bZIP_Maf_small; cd14717"
                     /db_xref="CDD:269865"
     misc_feature    328..537
                     /gene="LOC106082681"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269865"
     misc_feature    order(358..366,370..378,382..387,394..399,403..408)
                     /gene="LOC106082681"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:269865"
     misc_feature    order(406..408,415..420,427..432,436..441,448..453,
                     457..462,469..471,478..483,490..492,499..504,511..516)
                     /gene="LOC106082681"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:269865"
     polyA_site      803
                     /gene="LOC106082681"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccagctgtca ttgtgtggtg ctagttttcg ttaatttctc tataaagctt tacgaagatt
       61 aattactatt aatctctttt caaccaaaca acaacgcata aacttggaaa aaatcttatc
      121 tttaataact tgcaaaaaca acaactataa ttgccttaaa tggatccatt acaacagtca
      181 aggagtcgca atataaaatc aacaatggta actgatgatc tttatgcacc cttatcacca
      241 tgtcccattc cggatattag tgatgatgaa ttggtttcca tttctgtgcg agatttaaat
      301 cgcactctta aaatgcgagg tcttaatcgc gaagaaattg tacgtatgaa acaacgacgt
      361 cgtactctta agaatcgtgg ctatgctgct agttgtcgca ttaagcgcat agagcaaaaa
      421 gatgttttgg aaactgaaaa atcgcacgaa tggattgaat tggagcaaat gcatgaggaa
      481 aacgaacact gtagtcgaga gattgaaaat tggaaaaaga aatataatgc tctgttacag
      541 tttgcagctc acaatgatat acccataccg ccagaattag agggctgcta agatgggggg
      601 taatgcattt agccttggta tattccttgg tttttttgta gtgatatgat gtagaagagt
      661 gatttcagta caattttatt cctttcacta aatattttac tttctaagat tgtttttaga
      721 tttaagagaa acttgatata gatattttta aattaagctt tatgtataat acatttgtat
      781 gtatacgaat attataaaac caa