Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245341 803 bp mRNA linear INV 02-SEP-2023 (LOC106082681), transcript variant X2, mRNA. ACCESSION XM_013245341 VERSION XM_013245341.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245341.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..803 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..803 /gene="LOC106082681" /note="transcription factor MafK; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106082681" CDS 160..591 /gene="LOC106082681" /codon_start=1 /product="transcription factor MafK isoform X1" /protein_id="XP_013100795.1" /db_xref="GeneID:106082681" /translation="MDPLQQSRSRNIKSTMVTDDLYAPLSPCPIPDISDDELVSISVR DLNRTLKMRGLNREEIVRMKQRRRTLKNRGYAASCRIKRIEQKDVLETEKSHEWIELE QMHEENEHCSREIENWKKKYNALLQFAAHNDIPIPPELEGC" misc_feature 328..537 /gene="LOC106082681" /note="Basic leucine zipper (bZIP) domain of small musculoaponeurotic fibrosarcoma (Maf) proteins: a DNA-binding and dimerization domain; Region: bZIP_Maf_small; cd14717" /db_xref="CDD:269865" misc_feature 328..537 /gene="LOC106082681" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:269865" misc_feature order(358..366,370..378,382..387,394..399,403..408) /gene="LOC106082681" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:269865" misc_feature order(406..408,415..420,427..432,436..441,448..453, 457..462,469..471,478..483,490..492,499..504,511..516) /gene="LOC106082681" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:269865" polyA_site 803 /gene="LOC106082681" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccagctgtca ttgtgtggtg ctagttttcg ttaatttctc tataaagctt tacgaagatt 61 aattactatt aatctctttt caaccaaaca acaacgcata aacttggaaa aaatcttatc 121 tttaataact tgcaaaaaca acaactataa ttgccttaaa tggatccatt acaacagtca 181 aggagtcgca atataaaatc aacaatggta actgatgatc tttatgcacc cttatcacca 241 tgtcccattc cggatattag tgatgatgaa ttggtttcca tttctgtgcg agatttaaat 301 cgcactctta aaatgcgagg tcttaatcgc gaagaaattg tacgtatgaa acaacgacgt 361 cgtactctta agaatcgtgg ctatgctgct agttgtcgca ttaagcgcat agagcaaaaa 421 gatgttttgg aaactgaaaa atcgcacgaa tggattgaat tggagcaaat gcatgaggaa 481 aacgaacact gtagtcgaga gattgaaaat tggaaaaaga aatataatgc tctgttacag 541 tttgcagctc acaatgatat acccataccg ccagaattag agggctgcta agatgggggg 601 taatgcattt agccttggta tattccttgg tttttttgta gtgatatgat gtagaagagt 661 gatttcagta caattttatt cctttcacta aatattttac tttctaagat tgtttttaga 721 tttaagagaa acttgatata gatattttta aattaagctt tatgtataat acatttgtat 781 gtatacgaat attataaaac caa