Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245339 594 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013245339 VERSION XM_013245339.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245339.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..594 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..594 /gene="LOC106082680" /note="cytochrome c; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 34 Proteins" /db_xref="GeneID:106082680" CDS 66..392 /gene="LOC106082680" /codon_start=1 /product="cytochrome c" /protein_id="XP_013100793.1" /db_xref="GeneID:106082680" /translation="MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLFGRK TGQAPGFAYTDANKSKGITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPGERGDLIAY LKSATK" misc_feature 81..380 /gene="LOC106082680" /note="Cytochrome c2 [Energy production and conversion]; Region: Cyc7; COG3474" /db_xref="CDD:442697" polyA_site 594 /gene="LOC106082680" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tctcgaaact tttttccatt catttgtgtt caagagtccg cgctgtacaa atcgaaattt 61 caaatatggg tgttccagct ggtgatgttg aaaagggcaa gaagctattc gtccaacgtt 121 gtgcccaatg ccacaccgtt gaggccggag gcaaacataa agtaggcccc aatttgcatg 181 gtttgtttgg acgtaaaact ggccaagccc ctggattcgc ctacacagat gccaacaaat 241 ccaagggcat tacctggaat gaggatacat tgttcgaata cttggagaat cccaagaaat 301 acattcccgg cacaaaaatg atctttgctg gccttaagaa acctggagag cgtggtgatc 361 tcattgccta tctgaaatcg gccacaaaat aaattcaaaa aattacaagt tattatatac 421 atacaaataa attaatttat gtaaactaaa aaacctaaat caaattttac tttaactaat 481 gataatgtaa attaaatagt aaagatatat aattttaatt gatgtatatc ggacgcagtg 541 gtacaagaga cgtggacaaa atgtattaat aaacatttgt tgtattacct caca