Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans eukaryotic translation initiation


LOCUS       XM_013245332            1141 bp    mRNA    linear   INV 02-SEP-2023
            factor 3 subunit G-1 (LOC106082676), mRNA.
ACCESSION   XM_013245332
VERSION     XM_013245332.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245332.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1141
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1141
                     /gene="LOC106082676"
                     /note="eukaryotic translation initiation factor 3 subunit
                     G-1; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 12 Proteins"
                     /db_xref="GeneID:106082676"
     CDS             111..920
                     /gene="LOC106082676"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 3
                     subunit G-1"
                     /protein_id="XP_013100786.1"
                     /db_xref="GeneID:106082676"
                     /translation="MPAVDIKSSWADEVELDYGGLPPPTEVIENGFKYVTEYKYNKDD
                     KKTKVVRTYKITKEVVPKTVAKRRTWPKFGESKNDKPGPNSQTTMVAEEIFMQILNTK
                     EEEKSNDQLLDLSKNIAKCRICNGEHWSVNCPYKGTSMDTNLMEKKASAAAAAATEAP
                     KPGKYVPPFLKDSQKGGIGGIRGRDDTAAIRISNLSESMTEQDLEELIKRIGQHTKMY
                     LARDKNTGLCKGFAYVHFRQRKDAAAAIEILNGHGYDHLILSAEWSKPQNN"
     misc_feature    180..524
                     /gene="LOC106082676"
                     /note="Eukaryotic translation initiation factor 3 subunit
                     G; Region: eIF3g; pfam12353"
                     /db_xref="CDD:463545"
     misc_feature    678..902
                     /gene="LOC106082676"
                     /note="RNA recognition motif (RRM) found in eukaryotic
                     translation initiation factor 3 subunit G (eIF-3G) and
                     similar proteins; Region: RRM_eIF3G_like; cd12408"
                     /db_xref="CDD:409842"
     polyA_site      1141
                     /gene="LOC106082676"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaagaagaac tttgacattt tctttctttt tgcaaattac catccatttt gccctcgtgg
       61 atttgttaac tttttgtgta aaataatata agatatatca aatccataag atgccagctg
      121 ttgacattaa atcttcgtgg gccgatgagg tggagcttga ttacggtggt ctacctccac
      181 caaccgaagt aattgaaaat ggtttcaagt acgtcacaga gtataaatat aataaagatg
      241 acaagaaaac caaagttgtg cgcacataca aaatcacaaa ggaggtggta ccgaaaacag
      301 tggccaaacg ccgtacatgg ccaaagtttg gtgaatccaa gaatgataaa cctgggccaa
      361 attcccaaac aaccatggtc gccgaagaaa tctttatgca aatcttgaac accaaggagg
      421 aggagaagag caatgatcaa cttttggatc ttagcaagaa catcgccaag tgtcgtattt
      481 gtaatggtga gcattggtcc gtcaactgtc cgtacaaggg tacctcgatg gatacaaatc
      541 ttatggagaa aaaggcttcg gctgctgccg ccgctgctac agaagctccc aaacctggca
      601 agtatgtgcc cccgttcctc aaggacagtc aaaagggagg cattggtggt atacgtggtc
      661 gcgatgacac agccgctatt cgcatttcaa atttgtccga gtccatgacg gaacaagatt
      721 tagaggaact tattaagcgt attggacaac ataccaaaat gtatttggca cgcgacaaaa
      781 atactggcct atgcaaaggc tttgcttatg ttcacttccg ccaacgtaaa gatgctgctg
      841 ctgcaattga aattctcaac ggacatggtt atgatcattt gattcttagt gcggaatggt
      901 ccaaacctca aaataactga tacgtcgtaa gagattccac aaacacaaca tacaacaaca
      961 ataaataaaa gtcaataaga gaagcagcag tcttttatac aatcacatac atatatctaa
     1021 ttatctagag tacaggcgtt gagaattttg aaaaatgaaa acgtttgtta atactacgtt
     1081 cgctgaaaat ggaaaaaaca atttagaatg taaggttaca ataaaaactg gtaaccaaag
     1141 a