PREDICTED: Stomoxys calcitrans uncharacterized LOC106082673

LOCUS       XM_013245324             760 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082673), mRNA.
ACCESSION   XM_013245324
VERSION     XM_013245324.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..760
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..760
                     /gene="LOC106082673"
                     /note="uncharacterized LOC106082673; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082673"
     CDS             9..569
                     /gene="LOC106082673"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082673"
                     /protein_id="XP_013100778.1"
                     /db_xref="GeneID:106082673"
                     /translation="MLKNILTCLIALNVFLINQAFIKNNFNLECYRVTCEIVNPKVMK
                     QFECSYKKLGPKRYSGSGLVMFNQQLDKKFDIHIKIYVAPRGKIVKFLDWKLNVCDTL
                     YAGVSLPLARKIMWDVLKNSNFPRKCPFQANFLYNSSNIIVDESYFPKFTPSPMDLNI
                     SFEYIENQERFAIQRIFGATVPNARR"
     misc_feature    234..470
                     /gene="LOC106082673"
                     /note="Protein of unknown function (DUF1091); Region:
                     DUF1091; pfam06477"
                     /db_xref="CDD:461928"
     polyA_site      760
                     /gene="LOC106082673"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgcaaaaaat gttgaaaaat attctaactt gcctcatagc cttaaatgtt tttctgataa
       61 atcaggcctt cattaaaaac aatttcaatt tggagtgcta ccgtgtaact tgtgaaattg
      121 tcaatcctaa agtcatgaaa caatttgaat gttcctataa aaaattgggg cccaaacgat
      181 attctggcag tggtcttgtt atgttcaatc aacaattgga caagaaattc gatattcata
      241 ttaaaattta tgttgcaccc cgaggaaaaa ttgtaaaatt tcttgattgg aaactcaatg
      301 tatgtgatac gctttatgcg ggggtgtcat tgcctttggc cagaaaaatt atgtgggatg
      361 tcttaaaaaa tagtaatttt ccacgaaaat gtccattcca ggcgaatttc ctctacaatt
      421 catccaatat tatcgtcgat gaatcgtatt tccccaaatt tacaccatct cccatggatc
      481 tgaatatttc ttttgaatac attgaaaatc aagaaagatt tgcaattcaa cgaattttcg
      541 gagccactgt gcccaacgca aggagatgaa gaaatcttga aattcacacc caaggagcta
      601 ttgatgcttg atgttaacat cagattttca ttttgttgtt gcatggtctg tgtaatggaa
      661 ataagttaaa atatattcaa tatattcaaa cctaatcgaa aggggaataa caagttattt
      721 gtcaccaaac ggaaataaac aaacaagtaa aaactcataa