Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082672


LOCUS       XM_013245323             716 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082672), mRNA.
ACCESSION   XM_013245323
VERSION     XM_013245323.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245323.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..716
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..716
                     /gene="LOC106082672"
                     /note="uncharacterized LOC106082672; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082672"
     CDS             136..696
                     /gene="LOC106082672"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082672"
                     /protein_id="XP_013100777.2"
                     /db_xref="GeneID:106082672"
                     /translation="MLPKAIHFLILLDLLIICQASEKKDFNLVLGQPYYEIVNPQIIQ
                     RLEYFYKQLVPGRYSGNCIFILNQQLDKNLDVQLKILLGIRGKSVKFIDLKVNMCDIL
                     YRGMSMSIARKIMVNILQKSNFPRKCPFKANFIYNASNFIIDDSYFPKYTPYPMDFNV
                     SIDYFENQELIAMLQVKGSTVPKVKK"
ORIGIN      
        1 gtgttttaaa ctcttaagtg aaaatatcaa tgatatatag taagcgcagt cttgctataa
       61 cacgcaaaag attttcattg gttttcaaag ttagcttctt tttataaaac acatataatt
      121 ttgatttgta aaaaaatgtt gccaaaagcg atacattttc ttattttact ggatttgttg
      181 ataatatgtc aggcctctga aaaaaaggat ttcaacttgg tattgggtca gccatactat
      241 gaaatcgtaa accctcaaat tattcaacga ttagaatatt tctataagca attggtaccc
      301 ggtcgatatt ctggtaactg catttttatt ctcaatcaac aattggataa aaatctcgat
      361 gttcaattga aaattctact gggaattcgt ggaaaatctg ttaaattcat agatctaaag
      421 gtgaatatgt gtgatatcct atacagaggc atgtcaatgt ccatagctag gaaaattatg
      481 gtgaatattt tacaaaaaag caattttccg cgaaaatgtc ctttcaaagc gaattttatc
      541 tacaatgcat ccaatttcat catcgatgat tcgtactttc caaaatatac accatatccg
      601 atggatttta acgtttccat cgattacttt gaaaatcaag aactaattgc aatgctacag
      661 gttaaaggtt ccactgtgcc aaaggtgaag aaatgaaaga aagttctacc accaat