Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245323 716 bp mRNA linear INV 02-SEP-2023 (LOC106082672), mRNA. ACCESSION XM_013245323 VERSION XM_013245323.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245323.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..716 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..716 /gene="LOC106082672" /note="uncharacterized LOC106082672; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082672" CDS 136..696 /gene="LOC106082672" /codon_start=1 /product="uncharacterized protein LOC106082672" /protein_id="XP_013100777.2" /db_xref="GeneID:106082672" /translation="MLPKAIHFLILLDLLIICQASEKKDFNLVLGQPYYEIVNPQIIQ RLEYFYKQLVPGRYSGNCIFILNQQLDKNLDVQLKILLGIRGKSVKFIDLKVNMCDIL YRGMSMSIARKIMVNILQKSNFPRKCPFKANFIYNASNFIIDDSYFPKYTPYPMDFNV SIDYFENQELIAMLQVKGSTVPKVKK" ORIGIN 1 gtgttttaaa ctcttaagtg aaaatatcaa tgatatatag taagcgcagt cttgctataa 61 cacgcaaaag attttcattg gttttcaaag ttagcttctt tttataaaac acatataatt 121 ttgatttgta aaaaaatgtt gccaaaagcg atacattttc ttattttact ggatttgttg 181 ataatatgtc aggcctctga aaaaaaggat ttcaacttgg tattgggtca gccatactat 241 gaaatcgtaa accctcaaat tattcaacga ttagaatatt tctataagca attggtaccc 301 ggtcgatatt ctggtaactg catttttatt ctcaatcaac aattggataa aaatctcgat 361 gttcaattga aaattctact gggaattcgt ggaaaatctg ttaaattcat agatctaaag 421 gtgaatatgt gtgatatcct atacagaggc atgtcaatgt ccatagctag gaaaattatg 481 gtgaatattt tacaaaaaag caattttccg cgaaaatgtc ctttcaaagc gaattttatc 541 tacaatgcat ccaatttcat catcgatgat tcgtactttc caaaatatac accatatccg 601 atggatttta acgtttccat cgattacttt gaaaatcaag aactaattgc aatgctacag 661 gttaaaggtt ccactgtgcc aaaggtgaag aaatgaaaga aagttctacc accaat