Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized protein C3orf38


LOCUS       XM_013245321            1041 bp    mRNA    linear   INV 02-SEP-2023
            homolog (LOC106082670), mRNA.
ACCESSION   XM_013245321
VERSION     XM_013245321.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245321.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1041
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1041
                     /gene="LOC106082670"
                     /note="uncharacterized protein C3orf38 homolog; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:106082670"
     CDS             77..1000
                     /gene="LOC106082670"
                     /codon_start=1
                     /product="uncharacterized protein C3orf38 homolog"
                     /protein_id="XP_013100775.2"
                     /db_xref="GeneID:106082670"
                     /translation="MPITNKEKLGLMDLLEPPILIQVARSVTKNVVDISTPEEALEYI
                     LTHSSDCLTLLNKKAITKEILFRYLHRKKISISSDITKAILVNKVIEYWNDTTNLMPE
                     IEAKTEDSTEYPALAESAIGDSNVLSNKHIPTITSIASDQSEFPINLLARKFSEWFFN
                     NYNQHTLKHEDFWQDARLLLQITASDGSDLQDCDSSCSTLETLYETQQRFGFFFNPNL
                     SHSGVQGRMDVHGLVLVLACGTLHTHVDCVGIFECIFGLLRDPFSENNWKTKTIKLML
                     RSKGAPSIPSLQESDTLREALTLPVPEGDLT"
     polyA_site      1041
                     /gene="LOC106082670"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttggatgcg aaaataaaaa aagttataaa gcaaattgaa acatttttat atttctatgt
       61 atcaaacatt cagaacatgc cgatcacaaa caaagagaag cttggcctta tggatctcct
      121 agagccacca attctaatac aggtagcgag aagtgtcaca aaaaatgttg tagacatatc
      181 tacgcctgaa gaagccctgg agtatatact cacgcactcg tcagactgtc tgacgttgct
      241 aaataaaaag gccataacaa aagagatttt atttagatat ctacatcgaa aaaagatatc
      301 cataagcagt gatatcacca aagccatatt ggtgaacaag gtcatagagt attggaatga
      361 tacaacaaac ttaatgcctg aaatagaagc taaaacagag gatagtactg aatatcctgc
      421 cttagctgaa tcagctattg gtgattcaaa tgtgctgagc aataagcata taccaaccat
      481 tacgtcaatt gcctcggatc agtcagaatt cccaataaat ttgttggctc gcaaattttc
      541 cgaatggttt ttcaacaact acaaccagca cacattaaag catgaagatt tctggcagga
      601 tgctagactc ttattacaaa taacagccag tgatggcagt gaccttcaag actgtgatag
      661 ctcatgctca acattagaaa cgctctatga aactcaacaa cgttttggtt tcttcttcaa
      721 tcccaattta tcacattctg gtgtgcaggg acgtatggat gtgcatggat tggtgttggt
      781 tttggcatgt ggtaccttgc acacccatgt ggactgtgtt ggtatatttg aatgtatctt
      841 tggcttatta cgtgatccat tctccgagaa caattggaaa acaaaaacta taaaattaat
      901 gttaagaagc aagggagcgc cgagtatacc atctttacaa gaaagtgaca cattgaggga
      961 ggctttaact ttacccgtac ctgaaggaga tttgacttaa actaaataaa tctatgtaaa
     1021 tatattattg ttttgtatat a