Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245321 1041 bp mRNA linear INV 02-SEP-2023 homolog (LOC106082670), mRNA. ACCESSION XM_013245321 VERSION XM_013245321.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245321.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1041 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1041 /gene="LOC106082670" /note="uncharacterized protein C3orf38 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106082670" CDS 77..1000 /gene="LOC106082670" /codon_start=1 /product="uncharacterized protein C3orf38 homolog" /protein_id="XP_013100775.2" /db_xref="GeneID:106082670" /translation="MPITNKEKLGLMDLLEPPILIQVARSVTKNVVDISTPEEALEYI LTHSSDCLTLLNKKAITKEILFRYLHRKKISISSDITKAILVNKVIEYWNDTTNLMPE IEAKTEDSTEYPALAESAIGDSNVLSNKHIPTITSIASDQSEFPINLLARKFSEWFFN NYNQHTLKHEDFWQDARLLLQITASDGSDLQDCDSSCSTLETLYETQQRFGFFFNPNL SHSGVQGRMDVHGLVLVLACGTLHTHVDCVGIFECIFGLLRDPFSENNWKTKTIKLML RSKGAPSIPSLQESDTLREALTLPVPEGDLT" polyA_site 1041 /gene="LOC106082670" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttggatgcg aaaataaaaa aagttataaa gcaaattgaa acatttttat atttctatgt 61 atcaaacatt cagaacatgc cgatcacaaa caaagagaag cttggcctta tggatctcct 121 agagccacca attctaatac aggtagcgag aagtgtcaca aaaaatgttg tagacatatc 181 tacgcctgaa gaagccctgg agtatatact cacgcactcg tcagactgtc tgacgttgct 241 aaataaaaag gccataacaa aagagatttt atttagatat ctacatcgaa aaaagatatc 301 cataagcagt gatatcacca aagccatatt ggtgaacaag gtcatagagt attggaatga 361 tacaacaaac ttaatgcctg aaatagaagc taaaacagag gatagtactg aatatcctgc 421 cttagctgaa tcagctattg gtgattcaaa tgtgctgagc aataagcata taccaaccat 481 tacgtcaatt gcctcggatc agtcagaatt cccaataaat ttgttggctc gcaaattttc 541 cgaatggttt ttcaacaact acaaccagca cacattaaag catgaagatt tctggcagga 601 tgctagactc ttattacaaa taacagccag tgatggcagt gaccttcaag actgtgatag 661 ctcatgctca acattagaaa cgctctatga aactcaacaa cgttttggtt tcttcttcaa 721 tcccaattta tcacattctg gtgtgcaggg acgtatggat gtgcatggat tggtgttggt 781 tttggcatgt ggtaccttgc acacccatgt ggactgtgtt ggtatatttg aatgtatctt 841 tggcttatta cgtgatccat tctccgagaa caattggaaa acaaaaacta taaaattaat 901 gttaagaagc aagggagcgc cgagtatacc atctttacaa gaaagtgaca cattgaggga 961 ggctttaact ttacccgtac ctgaaggaga tttgacttaa actaaataaa tctatgtaaa 1021 tatattattg ttttgtatat a