Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245320 847 bp mRNA linear INV 02-SEP-2023 (LOC106082669), transcript variant X2, mRNA. ACCESSION XM_013245320 VERSION XM_013245320.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245320.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..847 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..847 /gene="LOC106082669" /note="selenoprotein BthD-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106082669" CDS 114..653 /gene="LOC106082669" /codon_start=1 /transl_except=(pos:252..254,aa:Sec) /product="selenoprotein BthD-like" /protein_id="XP_013100774.1" /db_xref="GeneID:106082669" /translation="MPPKRKRGATSVDASKSSATKKSKASDEPPKLKKNFPVLYVECC RSUSVFKRRAEALHREIVNLLTPLKSNIELQLCVNSDGPPRRGAFEVAISMEPSDDVD QRNLIWTGIKRTPRAQKFPAAEDMAEVIKKHLKLVSSDVSPLKQEESEQDEPDAKIST SDEEKPQKSSYSKGGRSKK" misc_feature 234..509 /gene="LOC106082669" /note="Rdx family; Region: Rdx; cl01407" /db_xref="CDD:470191" polyA_site 847 /gene="LOC106082669" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caaacagctg cattacaaaa aattaatttg agcgcgtaag tcaatagcat cttttgagca 61 tacaattcat tcagtacgaa catttcatta aaacgtctaa aaactaacac aatatgcccc 121 cgaaaaggaa aagaggagcc actagtgtgg atgcttctaa atcatcagct accaaaaaat 181 ccaaggcatc agatgaacca ccgaaattaa agaaaaactt tccagttctt tatgtagaat 241 gctgtcgttc ctgatccgtg tttaaaagac gggcagaagc attgcaccgt gagattgtta 301 atttgttaac ccctctaaaa tctaatatag aattacagtt gtgtgttaat tccgatggtc 361 ctccgagaag aggtgcattt gaagtagcca tatcaatgga accctccgat gacgttgacc 421 agcgcaatct catttggacg ggtataaagc gcactccacg agcacaaaaa ttcccagctg 481 ctgaagacat ggctgaagtt ataaagaagc atcttaagct tgtttcctcc gacgtatcac 541 ctttgaagca ggaggagtct gaacaagacg aacctgacgc taagatatcc acaagtgatg 601 aggagaagcc acaaaagagc tcgtattcta aaggtggaag gtcaaagaaa taatgccatt 661 tcttcatttt tgccatattt agcacttatg actttgttag tggtaaaacc ttttggagcc 721 ctctcaaacg aaccttttgc taatgacgaa aatattataa aacactggga attatgaatt 781 ctttggaaat atctatagaa attaagttgc tctcaataag cagaataaat atcttttata 841 aacaata