Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans selenoprotein BthD-like


LOCUS       XM_013245320             847 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082669), transcript variant X2, mRNA.
ACCESSION   XM_013245320
VERSION     XM_013245320.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245320.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..847
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..847
                     /gene="LOC106082669"
                     /note="selenoprotein BthD-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106082669"
     CDS             114..653
                     /gene="LOC106082669"
                     /codon_start=1
                     /transl_except=(pos:252..254,aa:Sec)
                     /product="selenoprotein BthD-like"
                     /protein_id="XP_013100774.1"
                     /db_xref="GeneID:106082669"
                     /translation="MPPKRKRGATSVDASKSSATKKSKASDEPPKLKKNFPVLYVECC
                     RSUSVFKRRAEALHREIVNLLTPLKSNIELQLCVNSDGPPRRGAFEVAISMEPSDDVD
                     QRNLIWTGIKRTPRAQKFPAAEDMAEVIKKHLKLVSSDVSPLKQEESEQDEPDAKIST
                     SDEEKPQKSSYSKGGRSKK"
     misc_feature    234..509
                     /gene="LOC106082669"
                     /note="Rdx family; Region: Rdx; cl01407"
                     /db_xref="CDD:470191"
     polyA_site      847
                     /gene="LOC106082669"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caaacagctg cattacaaaa aattaatttg agcgcgtaag tcaatagcat cttttgagca
       61 tacaattcat tcagtacgaa catttcatta aaacgtctaa aaactaacac aatatgcccc
      121 cgaaaaggaa aagaggagcc actagtgtgg atgcttctaa atcatcagct accaaaaaat
      181 ccaaggcatc agatgaacca ccgaaattaa agaaaaactt tccagttctt tatgtagaat
      241 gctgtcgttc ctgatccgtg tttaaaagac gggcagaagc attgcaccgt gagattgtta
      301 atttgttaac ccctctaaaa tctaatatag aattacagtt gtgtgttaat tccgatggtc
      361 ctccgagaag aggtgcattt gaagtagcca tatcaatgga accctccgat gacgttgacc
      421 agcgcaatct catttggacg ggtataaagc gcactccacg agcacaaaaa ttcccagctg
      481 ctgaagacat ggctgaagtt ataaagaagc atcttaagct tgtttcctcc gacgtatcac
      541 ctttgaagca ggaggagtct gaacaagacg aacctgacgc taagatatcc acaagtgatg
      601 aggagaagcc acaaaagagc tcgtattcta aaggtggaag gtcaaagaaa taatgccatt
      661 tcttcatttt tgccatattt agcacttatg actttgttag tggtaaaacc ttttggagcc
      721 ctctcaaacg aaccttttgc taatgacgaa aatattataa aacactggga attatgaatt
      781 ctttggaaat atctatagaa attaagttgc tctcaataag cagaataaat atcttttata
      841 aacaata