PREDICTED: Stomoxys calcitrans uncharacterized LOC106082663

LOCUS       XM_013245313             564 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082663), mRNA.
ACCESSION   XM_013245313
VERSION     XM_013245313.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245313.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..564
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..564
                     /gene="LOC106082663"
                     /note="uncharacterized LOC106082663; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106082663"
     CDS             1..564
                     /gene="LOC106082663"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082663"
                     /protein_id="XP_013100767.2"
                     /db_xref="GeneID:106082663"
                     /translation="MEQYAVLLSIITLSSLIMVQASEEKKFSMEFHKVDCIISNPRVI
                     KRFECFYEKLGPSRYLSEAVFILNQQLDKTIESHIRIHIGTGGKIVKFLDMRVNVCDT
                     LKAGISVPILRKIIALLMESSNFPRKCPLKANFLYNMSNLIVDDSFFPKYTPYPMVFN
                     YTTDIYSNQKKIAIIHIEGALVAKKNK"
ORIGIN      
        1 atggagcaat atgctgtcct attgtctatt attaccttaa gttccttgat tatggtacaa
       61 gcttccgaag aaaagaagtt cagcatggag ttccacaaag tagactgtat aatttccaac
      121 ccaagagtta ttaaacgatt tgaatgtttc tatgaaaaat tgggaccaag tcgatattta
      181 agtgaagccg ttttcatttt gaatcaacaa ttggacaaaa ctattgaatc ccatattagg
      241 atacatattg gaactggtgg aaaaatagta aaattcttag atatgagagt taatgtgtgt
      301 gataccctaa aagcaggtat ttctgtaccc atattgagga aaatcatagc cctacttatg
      361 gaaagtagca attttcctag aaaatgccct ctgaaggcga atttcctcta caatatgtcg
      421 aatttaatcg tcgatgattc attcttccct aaatacacac catatcccat ggtcttcaac
      481 tataccacag atatctactc aaatcagaaa aaaattgcta taatacacat tgaaggggct
      541 cttgtggcta agaagaataa atga