Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans vanin-like protein 1 (LOC106082635),


LOCUS       XM_013245264            1681 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013245264
VERSION     XM_013245264.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245264.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1681
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1681
                     /gene="LOC106082635"
                     /note="vanin-like protein 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 14
                     Proteins"
                     /db_xref="GeneID:106082635"
     CDS             41..1621
                     /gene="LOC106082635"
                     /codon_start=1
                     /product="vanin-like protein 1"
                     /protein_id="XP_013100718.2"
                     /db_xref="GeneID:106082635"
                     /translation="MYKIPAVFFGLCALFFELSTQASLPSDLYYNAGVVEFRPSAAMT
                     SESRLNDNLAGYLEILASKEAESLDIIVFPESTLNNNDDMTFVPNPSKVKVIPCDAEE
                     GEDYHNVLKQLSCAARKYAKYLVINLTEKELCSEVLEDPRPCASNGLNIFNTNVVFDR
                     QGTVISRYRKVHLYGENKNFTYVPEFGWFETDFGVRFGHFICFDILFYSPAQEMVDKH
                     GIKDFIFTTMWFSQLPFLTAVQIQQAWSYGNDVNLLAAGASNPVAGSTGTGIYNGRNG
                     TLVAVMNQGLGKRTLYVSRVPKYPHQKHRARRSLPSAPTTRLEKPDIFLKRDYLQFYD
                     TISVDLSKGTHLSQKLCNSNSSLCCSFDLHWQPLSLNEDSQHYHYRLGAFRGIRNEAA
                     VEKNKLMNCALISCIGKEDIMDCGKVHSINTDVIFENITIEATFPKANGFLLMPNSLK
                     ASDLMPVAVGEFEWSEVVRNDNQIDVRYSLNTSTSNLLAFSIYGNYYDGYGLGDGASS
                     MVMSTLCGLIVVLVHLYL"
     polyA_site      1681
                     /gene="LOC106082635"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcggagttgt taaggtaaag acggctttca aactacggaa atgtataaaa ttccagcggt
       61 attcttcggt ttgtgcgcgc ttttcttcga gctatcgaca caggccagtt taccaagtga
      121 tttatactac aatgctggtg tggtggaatt tcgaccttcg gcagcgatga ccagcgaaag
      181 tcgtctcaat gataatttgg cgggatattt ggaaatattg gcttccaaag aggctgagtc
      241 attggacata atagtgtttc cggagagtac tttgaacaat aatgacgata tgacatttgt
      301 gccaaatcct tccaaagtaa aggtgatccc gtgcgatgcc gaagaggggg aggattacca
      361 taatgtgcta aaacagctgt cctgtgcagc ccgcaagtac gccaagtatc ttgttatcaa
      421 tttaaccgaa aaggaattgt gctccgaggt tcttgaggac cccaggccct gtgccagcaa
      481 tggcctaaat atattcaata ccaatgtggt cttcgatcgc cagggaacag tgatatcgcg
      541 ttaccgcaag gtccatctgt atggggaaaa caaaaatttc acttatgtgc ctgagtttgg
      601 atggttcgaa acagattttg gtgtgcgctt cggccacttt atatgcttcg atatactctt
      661 ttactcgccg gctcaagaaa tggtagacaa gcacggtatc aaagatttta tttttaccac
      721 tatgtggttc tcacagctgc ccttcctaac agctgttcaa atacaacagg cctggtctta
      781 tggaaatgat gtcaatctgc tggcagcagg tgcttccaat ccagtggcgg gtagcacagg
      841 tacaggcatt tataatggac gcaatggcac tctggtggct gtcatgaatc agggattggg
      901 gaaacgcact ctatatgtgt cccgggtgcc caaatatccg catcaaaagc atagggcaag
      961 aagatcttta ccatctgccc ccaccacaag actagaaaaa ccagatattt ttctaaaacg
     1021 ggattatcta caattttatg acaccatttc agtggatctt agtaagggca ctcatttatc
     1081 gcaaaaattg tgcaactcca attcgtcatt atgttgctca ttcgatttgc attggcagcc
     1141 cttgtcactc aatgaggatt cccagcatta tcactatcgc ctgggggctt ttaggggcat
     1201 acgcaatgag gcggccgtcg aaaaaaataa actcatgaat tgtgccttaa tcagctgcat
     1261 aggcaaggag gacataatgg attgtggcaa ggtgcacagc atcaatacgg atgttatttt
     1321 tgagaatatt accattgagg ctacctttcc gaaagccaat ggtttcctct taatgcccaa
     1381 tagtttgaag gcaagtgatt taatgcctgt ggcagtagga gaatttgaat ggtctgaagt
     1441 tgtaagaaac gacaaccaaa tcgatgttcg ctacagtttg aatacctcca ccagtaatct
     1501 cttggctttt tcaatttatg gcaattatta tgacggctat ggcttgggtg atggtgcttc
     1561 ttcaatggtg atgtctactt tgtgcggatt aattgtcgtt ttagttcatc tatacttgta
     1621 gggaattaaa tacgattttt ctaaaaacaa caaatcaata aacttacaac aagtaaatct
     1681 a