Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013245250 1208 bp mRNA linear INV 02-SEP-2023 (LOC106082628), mRNA. ACCESSION XM_013245250 VERSION XM_013245250.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013245250.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1208 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1208 /gene="LOC106082628" /note="uncharacterized LOC106082628; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106082628" CDS 90..1142 /gene="LOC106082628" /codon_start=1 /product="uncharacterized protein LOC106082628" /protein_id="XP_013100704.1" /db_xref="GeneID:106082628" /translation="MPRNLWGEFKEDEKTQQNELTKMVPVSAKRLKLSEVQNQLPAEV SKNVTVKVKNPLVTQTIEVMKQTEMLQSLIDTYSNKSGTSNYLLNPCQMIPEVNFPPE NVANFVTDDKFTKPIWFVPPQDTNFAKGVPQHYPQITSDICRASLRKAVCGQMRVAGF TDTAESALILFADACEEFILNLMQTIREVHANDQKLETQRDIEVKNLEKAYYSMTNNS LTQVHNYFKHHLIAKNRLEIAEFNGVFQEYDKLMKESQSMQKEEFQEGDFMNIFEMPS TSDGNNLAMQDFSNTTTGNISNNVNIVNQNTLINLLDGQNQITIQQQPQDGGTQTTVD LQTYTTDINTHFQPQE" misc_feature 504..767 /gene="LOC106082628" /note="histone fold domain (HFD) superfamily; Region: HFD_SF; cl45933" /db_xref="CDD:480273" polyA_site 1208 /gene="LOC106082628" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtggcgtcaa cacctgtgaa atgttttgtt gataaacaat tatttctgct tatgcgacat 61 atttgataaa atataaatta ttgattaaaa tgccccgaaa tctttggggc gagtttaagg 121 aagatgaaaa gacgcaacag aatgagttga ccaaaatggt ccccgtaagt gcaaaaaggc 181 tgaaattatc cgaagttcaa aatcaactac cggccgaagt gagcaaaaat gtaacagtta 241 aagtgaaaaa tcctttggtt acacagacta tagaggtgat gaagcaaacc gagatgttac 301 aatctctgat tgacacctat tccaataaat ccggtacttc aaactatcta ttgaatccat 361 gtcaaatgat accagaggtt aatttcccac ccgagaatgt ggccaatttt gtgacagatg 421 ataaatttac taaacctata tggtttgttc caccacaaga taccaacttc gccaaaggtg 481 taccccaaca ttatcctcaa ataacttcag atatatgtag agcatctttg cgtaaagcag 541 tatgtggtca aatgcgagtg gctggcttta cagataccgc agaatctgct ctcatactgt 601 ttgccgatgc ttgtgaggaa tttatattga atctaatgca aactattcga gaagtccatg 661 caaatgatca aaaattggaa acacaacgtg acattgaagt taaaaatcta gagaaggctt 721 attattctat gaccaataat tccttgactc aagtccacaa ttatttcaag catcatttga 781 tagcaaagaa tcgcttggaa atagcagaat ttaatggtgt attccaggaa tacgataaac 841 tgatgaaaga aagtcaaagt atgcaaaaag aagaatttca agagggcgat tttatgaata 901 tttttgaaat gccatcaaca tcggacggca ataatttagc tatgcaagat ttttcaaaca 961 ccacaacagg aaatatatcc aacaacgtta atatagtcaa tcagaatacg ctgataaacc 1021 ttttagatgg ccaaaatcaa ataacaatcc agcaacaacc acaagatgga gggacacaaa 1081 caactgttga tctgcagaca tacaccaccg atataaatac acattttcaa ccacaagaat 1141 aaaatttcca gtgaaatatg aaaaaaggag ttttactaaa tataaacatc catggaaaat 1201 gacgacaa