Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans tryptophan 2,3-dioxygenase


LOCUS       XM_013245247            1431 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082625), mRNA.
ACCESSION   XM_013245247
VERSION     XM_013245247.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013245247.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1431
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1431
                     /gene="LOC106082625"
                     /note="tryptophan 2,3-dioxygenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 26
                     Proteins"
                     /db_xref="GeneID:106082625"
     CDS             102..1226
                     /gene="LOC106082625"
                     /codon_start=1
                     /product="tryptophan 2,3-dioxygenase"
                     /protein_id="XP_013100701.1"
                     /db_xref="GeneID:106082625"
                     /translation="MSCPYASTFNGAEHDDKAVPLNTEVGKIYGEYLMLDNLLSAQCM
                     SSNVHDEHLFIITHQAYELWFKQIIFEFDSIREMLNSEIIEETKTLEILKRLNRVVMI
                     LKLLVDQVPILETMTPLDFMDFRNNLSPASGFQSLQFRLIENKLGVKSEHRVKYNQKY
                     SEAFGNNTASINAIIESESEPSLLELIEKWLERTPGLEETGFNFWHKFQVSVDKFLQD
                     QVKSAMSEQVENAKNYRLMDIEKRREVYRSIFDPAIHEAMVSRGDRRFSHKALQGAIM
                     ITFYRDEPRFSQPHQLLTLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYL
                     RSTLSDRYKVFLDLFNLSTFLIPREAIPPLDDSIRRALIN"
     misc_feature    147..1166
                     /gene="LOC106082625"
                     /note="Tryptophan 2,3-dioxygenase; Region:
                     Trp_dioxygenase; pfam03301"
                     /db_xref="CDD:281317"
     polyA_site      1431
                     /gene="LOC106082625"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcagtttcaa ttcatcttcc actcgaggcg gttacgtttg caacggttcg gagtactgtc
       61 aattgcgtaa ataaaaaaac aaaaaaaaaa aaactacaag aatgtcttgt ccctacgcct
      121 caacgtttaa tggagcagaa cacgatgaca aagccgtgcc gcttaataca gaagtgggaa
      181 aaatttatgg cgaatatttg atgctagaca atctccttag tgcccagtgc atgtcttcaa
      241 atgtgcacga tgaacatttg tttataatca ctcaccaagc ctatgaactt tggtttaagc
      301 aaatcatttt cgaattcgat tccatacgag aaatgttgaa tagtgaaata attgaagaaa
      361 ccaaaacatt ggagatattg aaacgcctca atagagtggt catgatactg aagctcttgg
      421 tcgatcaagt gccgattctg gaaactatga cccccttgga tttcatggac ttccgcaata
      481 atctgtcccc agcctcagga tttcaaagtt tacaatttcg tttgatcgag aataagttgg
      541 gtgttaaatc ggaacatcgt gttaaatata atcaaaaata ttccgaagct tttggaaata
      601 atacagcatc gataaatgcc atcatcgaat cggaatctga accatctctc ttggaattga
      661 tagagaaatg gttggaacga actccaggtt tggaagagac aggctttaat ttctggcata
      721 aatttcaagt cagcgttgat aagtttttgc aagatcaagt gaagagtgcc atgagtgaac
      781 aagtggaaaa tgccaaaaat tatcgcctta tggatattga aaaacgtcgt gaggtttatc
      841 gcagcatttt tgatccagcc attcatgaag ccatggtctc acgtggtgat cgccgtttta
      901 gtcacaaagc tttgcaaggc gcgattatga tcactttcta tcgtgatgaa cctcgcttca
      961 gtcaaccaca tcaattgttg actctattga tggatattga ctcattgatc accaaatgga
     1021 gatataacca cgtcattatg gttcaacgta tgattggctc ccaacaattg ggtaccggtg
     1081 gctcttcggg ctatcaatac ttgagatcca ccctaagtga tcgctataag gttttcttgg
     1141 atttattcaa cttgtctacc ttcttgatac cacgcgaagc cataccacca ctggatgatt
     1201 ccataagacg tgctttaatt aactaaataa gccaatgata tggaacaagg tccaaaaaca
     1261 caaacgaatt cagaaaaaat aatcccaaca atgtaataat taaaaaaatg gtaaaaataa
     1321 aaaaacaaac ataatttgct caagaatgaa gaaaaatatt tttttacaaa tttaaaatgt
     1381 tttaaaaaaa aattttggag aaaaggattc aaaataaact tcataaaagt t