Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082167


LOCUS       XM_013244521             508 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082167), mRNA.
ACCESSION   XM_013244521
VERSION     XM_013244521.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244521.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..508
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..508
                     /gene="LOC106082167"
                     /note="uncharacterized LOC106082167; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106082167"
     CDS             114..404
                     /gene="LOC106082167"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082167"
                     /protein_id="XP_013099975.1"
                     /db_xref="GeneID:106082167"
                     /translation="MLRNARSCNSLAARLYSQGTGAAKPTATATKPPTSNVTGLSSNC
                     VKPTTGPVGPGAAADSPNYKVPEYFLFNRFSYAEAEVEMAKYRCPQPSALKK"
     misc_feature    300..392
                     /gene="LOC106082167"
                     /note="NADH dehydrogenase [ubiquinone] flavoprotein 3,
                     mitochondrial; Region: NDUFV3; pfam15880"
                     /db_xref="CDD:464921"
     polyA_site      508
                     /gene="LOC106082167"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gacatttgtc attttgggca gtcgtttgcg taagattacg tgaatttaga catttgttaa
       61 ttgttgaaga aattattaaa atattttatc gttcactaaa agcgcttagt aaaatgttgc
      121 gaaacgctcg ttcctgcaat tcacttgctg cacgcttgta ttcccaggga actggagctg
      181 caaaaccaac agcaactgcc accaaacctc caacttcaaa tgtcacaggt ctgagctcca
      241 attgtgtgaa acccacaact ggtccagtgg gtcctggcgc tgccgctgat agtccaaact
      301 acaaagttcc agaatatttt ttatttaatc gtttctccta tgctgaggcc gaagttgaaa
      361 tggccaaata tcgctgtccc caaccatccg ctttgaagaa gtaaataact ctaaacaatg
      421 ttttagcaaa attgttggaa aaaaaattca attgtaaatg aatgagtgtt ttattgatgt
      481 gaagaataaa tctatacaat tagcgtga