Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013244521 508 bp mRNA linear INV 02-SEP-2023 (LOC106082167), mRNA. ACCESSION XM_013244521 VERSION XM_013244521.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013244521.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..508 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..508 /gene="LOC106082167" /note="uncharacterized LOC106082167; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106082167" CDS 114..404 /gene="LOC106082167" /codon_start=1 /product="uncharacterized protein LOC106082167" /protein_id="XP_013099975.1" /db_xref="GeneID:106082167" /translation="MLRNARSCNSLAARLYSQGTGAAKPTATATKPPTSNVTGLSSNC VKPTTGPVGPGAAADSPNYKVPEYFLFNRFSYAEAEVEMAKYRCPQPSALKK" misc_feature 300..392 /gene="LOC106082167" /note="NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial; Region: NDUFV3; pfam15880" /db_xref="CDD:464921" polyA_site 508 /gene="LOC106082167" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gacatttgtc attttgggca gtcgtttgcg taagattacg tgaatttaga catttgttaa 61 ttgttgaaga aattattaaa atattttatc gttcactaaa agcgcttagt aaaatgttgc 121 gaaacgctcg ttcctgcaat tcacttgctg cacgcttgta ttcccaggga actggagctg 181 caaaaccaac agcaactgcc accaaacctc caacttcaaa tgtcacaggt ctgagctcca 241 attgtgtgaa acccacaact ggtccagtgg gtcctggcgc tgccgctgat agtccaaact 301 acaaagttcc agaatatttt ttatttaatc gtttctccta tgctgaggcc gaagttgaaa 361 tggccaaata tcgctgtccc caaccatccg ctttgaagaa gtaaataact ctaaacaatg 421 ttttagcaaa attgttggaa aaaaaattca attgtaaatg aatgagtgtt ttattgatgt 481 gaagaataaa tctatacaat tagcgtga