Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082162


LOCUS       XM_013244513             637 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082162), mRNA.
ACCESSION   XM_013244513
VERSION     XM_013244513.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244513.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..637
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..637
                     /gene="LOC106082162"
                     /note="uncharacterized LOC106082162; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106082162"
     CDS             76..618
                     /gene="LOC106082162"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082162"
                     /protein_id="XP_013099967.2"
                     /db_xref="GeneID:106082162"
                     /translation="MNGTTAFEPVPTKAALALKNKQRTEFKALIFEEPKINRDFELNQ
                     PLVTKKNKISNSRPDEDGNAFDIKKARHEVINFAMNNQRIQKNQKKMQIFQMVQLGAK
                     PPKKEHKNYKELLDEKRRLKDIREARKKFHQLGKNQTGAASVKCRSKTKIEKQSKKRV
                     PVSSIDQHYGVARPKLKKKK"
ORIGIN      
        1 aataacacga gtaaaaccct gaccaaaaga ctttatatta ttattatttt gtaatttgtg
       61 atttattgcg ggaacatgaa tggaacgacg gcctttgagc ctgtacctac aaaggctgcg
      121 ctagctctta aaaataaaca aaggactgag tttaaagcgt taattttcga agaacctaaa
      181 atcaacaggg atttcgaact gaaccagccc ctagtgacca agaaaaataa aatctcaaat
      241 tcaagacctg atgaagacgg aaatgccttt gatatcaaga aagctcgtca tgaagtaata
      301 aattttgcca tgaacaacca gcgtattcaa aagaatcaaa agaaaatgca aatatttcaa
      361 atggtgcagt taggagcaaa gccgccaaag aaggaacaca aaaattacaa agaactgctg
      421 gatgaaaaac gtcgtttaaa ggatatacga gaagccagaa agaaatttca tcagttgggt
      481 aaaaatcaaa caggagcagc ttcagtaaaa tgccgcagta aaaccaaaat agaaaagcaa
      541 tctaagaaac gagttccagt gtcatctata gaccagcatt atggtgttgc tagaccaaag
      601 ttaaagaaga aaaaatgaat aaaattaaag tttatta