Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013244513 637 bp mRNA linear INV 02-SEP-2023 (LOC106082162), mRNA. ACCESSION XM_013244513 VERSION XM_013244513.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013244513.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..637 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..637 /gene="LOC106082162" /note="uncharacterized LOC106082162; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106082162" CDS 76..618 /gene="LOC106082162" /codon_start=1 /product="uncharacterized protein LOC106082162" /protein_id="XP_013099967.2" /db_xref="GeneID:106082162" /translation="MNGTTAFEPVPTKAALALKNKQRTEFKALIFEEPKINRDFELNQ PLVTKKNKISNSRPDEDGNAFDIKKARHEVINFAMNNQRIQKNQKKMQIFQMVQLGAK PPKKEHKNYKELLDEKRRLKDIREARKKFHQLGKNQTGAASVKCRSKTKIEKQSKKRV PVSSIDQHYGVARPKLKKKK" ORIGIN 1 aataacacga gtaaaaccct gaccaaaaga ctttatatta ttattatttt gtaatttgtg 61 atttattgcg ggaacatgaa tggaacgacg gcctttgagc ctgtacctac aaaggctgcg 121 ctagctctta aaaataaaca aaggactgag tttaaagcgt taattttcga agaacctaaa 181 atcaacaggg atttcgaact gaaccagccc ctagtgacca agaaaaataa aatctcaaat 241 tcaagacctg atgaagacgg aaatgccttt gatatcaaga aagctcgtca tgaagtaata 301 aattttgcca tgaacaacca gcgtattcaa aagaatcaaa agaaaatgca aatatttcaa 361 atggtgcagt taggagcaaa gccgccaaag aaggaacaca aaaattacaa agaactgctg 421 gatgaaaaac gtcgtttaaa ggatatacga gaagccagaa agaaatttca tcagttgggt 481 aaaaatcaaa caggagcagc ttcagtaaaa tgccgcagta aaaccaaaat agaaaagcaa 541 tctaagaaac gagttccagt gtcatctata gaccagcatt atggtgttgc tagaccaaag 601 ttaaagaaga aaaaatgaat aaaattaaag tttatta