Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans septin-1 (LOC106082110), transcript


LOCUS       XM_013244446            1383 bp    mRNA    linear   INV 02-SEP-2023
            variant X4, mRNA.
ACCESSION   XM_013244446
VERSION     XM_013244446.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244446.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1383
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1383
                     /gene="LOC106082110"
                     /note="septin-1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 11 Proteins"
                     /db_xref="GeneID:106082110"
     CDS             101..1171
                     /gene="LOC106082110"
                     /codon_start=1
                     /product="septin-1 isoform X3"
                     /protein_id="XP_013099900.1"
                     /db_xref="GeneID:106082110"
                     /translation="MKFSSIETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
                     STLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDA
                     IDNSDSFSAILEYIDEQYERFLRDESGLNRRNIVDNRIHCCFYFISPFGHGLKPLDVE
                     FMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIEDHGIKIYPLPDCDSDEDEDY
                     KEQVKQLKAAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPEHCDFIKLRTMLIT
                     HMQDLQEVTQEVHYENYRSDRLAKGIKNKENGIIKPERDSVVPTQIVLNEKDRILQEK
                     EAELRRMQEMLAQMQAKMQAQQ"
     misc_feature    185..1000
                     /gene="LOC106082110"
                     /note="Region: Septin; pfam00735"
                     /db_xref="CDD:395596"
     misc_feature    212..235
                     /gene="LOC106082110"
                     /note="G1 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    order(218..238,383..385,392..394,626..631,635..637,
                     803..808)
                     /gene="LOC106082110"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206649"
     misc_feature    308..334
                     /gene="LOC106082110"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206649"
     misc_feature    314..316
                     /gene="LOC106082110"
                     /note="G2 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    383..394
                     /gene="LOC106082110"
                     /note="G3 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    order(389..496,497..526)
                     /gene="LOC106082110"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206649"
     misc_feature    626..637
                     /gene="LOC106082110"
                     /note="G4 box; other site"
                     /db_xref="CDD:206649"
     misc_feature    803..811
                     /gene="LOC106082110"
                     /note="G5 box; other site"
                     /db_xref="CDD:206649"
     polyA_site      1383
                     /gene="LOC106082110"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtcttatcg tgtattgtgc agccaattcg ggtgtgccat attacctgca agcatttcct
       61 gacaatgggg agaaattaat attgcttggt gcttggtgcc atgaagtttt ccagtatcga
      121 aacacccgga tatgtggggt ttgccaatct tcccaatcag gtacatagaa aatcggtgaa
      181 aaagggtttt gaattcactc ttatggttgt gggcgaatcg ggtctgggaa aatccacact
      241 ggtcaatagt ttgttcctaa cagatcttta tcccgaacgc ataatacccg atgccataga
      301 aaaacaaaaa caaacggtga aattggaagc atcaacagtg gaaattgaag agcgtggtgt
      361 caagctgcgt ttgacggttg tggatacacc tggtttcggt gatgccatcg ataactcgga
      421 cagttttagt gccatattgg aatacattga cgagcaatac gaaagatttc tgcgtgacga
      481 gagtggctta aatcgccgca atattgtgga taatcgtata cactgttgtt tctattttat
      541 atcgccattt ggtcatggtt taaaaccgct cgatgtggaa ttcatgaaga aattacattc
      601 caaagtcaat attgtgcctg tgattgccaa agccgattgc cttacgaaaa aggaaatact
      661 acgtttgaaa tgtcgcatca tgcaggaaat cgaagatcat ggcatcaaaa tctatccctt
      721 gccggattgt gattcggatg aagatgagga ctacaaggaa caggttaagc aactgaaagc
      781 agcagtgcca tttgccgttt gtggagcaaa tactctactt gaagttaaag gcaagaaagt
      841 gcggggacgt ttatatccct ggggtgtagt ggaggtggaa aatccagaac actgtgattt
      901 cattaaacta aggacgatgc taatcaccca catgcaagac ttacaagagg tcacccaaga
      961 ggtccattat gaaaactatc gttcagatcg tctggccaag ggcattaaaa acaaagagaa
     1021 tggcatcatc aagccagagc gcgactccgt ggtacccaca cagatagtgt tgaatgaaaa
     1081 ggatcgaata ctgcaagaaa aggaagccga gttgagacgt atgcaggaaa tgctggcaca
     1141 aatgcaagcc aaaatgcaag cgcaacaata agtcattata agacctcgta acggggtttg
     1201 ttcaaacgac aaaacacaca ctcccacaaa aacatgcata catacataca acaccctcac
     1261 cttttatctc taggcatata gaaattttat aacacacaca cacaagaaaa atggtgccga
     1321 atttcaaatg tttttttaca catatatata tatatataaa atgtagaata tttaaaatct
     1381 caa