Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082099


LOCUS       XM_013244426             914 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082099), mRNA.
ACCESSION   XM_013244426
VERSION     XM_013244426.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244426.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..914
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..914
                     /gene="LOC106082099"
                     /note="uncharacterized LOC106082099; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082099"
     CDS             44..733
                     /gene="LOC106082099"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082099"
                     /protein_id="XP_013099880.2"
                     /db_xref="GeneID:106082099"
                     /translation="MFRRSILPMAKNFINLDYRLITLDRYKDVMFHLRDMCAQTDPLN
                     KTICECIRKGGDEFVEYFTYKTLNDELSLMALNSQGNIVGIVLNGVANPEYLQDLKNC
                     LTKIKDSHLQSILQLQLEENMKNNIFDLCKTRKVFETRLLSVDSRNYNGRIMGKQLIR
                     LSEIVAGNKDHKVMKADATGNFSQKIFSYCGFKCLNEVPYNNYSKKDDNSIKLRNLPH
                     SKYQLLYKLLR"
     polyA_site      914
                     /gene="LOC106082099"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcaaaaatt ttcaaaaaaa aatcaaaatc ttaatcatct aaaatgttta gacgaagtat
       61 tttgcctatg gctaaaaatt tcattaattt agactacaga ctcataactc tcgatcgcta
      121 taaggatgta atgtttcatt taagggatat gtgtgcacaa accgatccat taaataaaac
      181 aatttgcgag tgcatacgta agggaggcga tgaatttgta gaatatttta catataaaac
      241 gctcaacgat gaactaagcc taatggccct taacagccaa gggaatattg ttggcattgt
      301 tctcaatggt gttgcaaatc ccgagtacct acaggattta aaaaattgct taactaaaat
      361 aaaagattcg catttgcaaa gtatactcca attgcaattg gaagagaata tgaagaacaa
      421 tatctttgat ctttgtaaaa ccagaaaagt attcgagaca cgcctacttt cggttgatag
      481 cagaaattat aatggacgca tcatgggtaa acaattgatt cgtctaagtg aaatagtagc
      541 tggcaataag gaccataagg ttatgaaagc cgatgcaact ggtaattttt ctcaaaagat
      601 attttcatac tgtggtttca agtgtttgaa cgaggtccct tataacaact attcaaaaaa
      661 ggatgacaac tcaataaagt tgcggaattt accacattcc aaatatcaat tactatacaa
      721 actattacgt taaagattac attttcaagg ctgtgtttaa gttatatgca tggcaaaaca
      781 agcggttcgt agttatcagt ttgcactgcc aaactatcta gtacatctga cttgcactga
      841 atagaagaaa aataaaacat gaccattgta aagtttttgg aaataataaa taacgttaaa
      901 tttacttact tgaa