Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082098


LOCUS       XM_013244425             908 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082098), mRNA.
ACCESSION   XM_013244425
VERSION     XM_013244425.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244425.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..908
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..908
                     /gene="LOC106082098"
                     /note="uncharacterized LOC106082098; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106082098"
     CDS             87..749
                     /gene="LOC106082098"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082098"
                     /protein_id="XP_013099879.2"
                     /db_xref="GeneID:106082098"
                     /translation="MSINWIKITDRAREGIKIINALPYNTFSTVLQYVHRQMITTGGG
                     ADSKGENVSSSAENENALEELERLVGVPRPDFLLLIKTFSYILRRTSTYIIKPSLLQT
                     ELRDKLQLQDEAKIDAIVRLWVRQTTPIMNNLARDCYESNEIADVAWKLNVEISSHCQ
                     QREKTALAVLQLKTGAGEDINMEMNHEELLQLYQQFECIQNELDAMNAQPKIETTKPA
                     QM"
     polyA_site      908
                     /gene="LOC106082098"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcgtttgttt gttattggtt tgcatgttca ggaagttgtc gtggaaatag ttatcgtgtt
       61 tcctttaccg ttacctatag tggacaatga gcattaactg gataaaaata actgatagag
      121 ctcgagaggg tataaaaatt ataaatgcct tgccttacaa tacatttagt accgtgcttc
      181 aatatgtaca tcgccaaatg attactactg gaggtggtgc agattccaag ggcgagaatg
      241 tttcatccag tgccgagaat gaaaatgctt tggaagaatt ggaacgccta gtcggtgtgc
      301 cccgtcctga ttttttgttg ttgatcaaaa ctttctccta tatattgagg cgcaccagca
      361 catacattat aaaaccttcg ttgcttcaaa cagagctaag ggataagtta caattacaag
      421 atgaagcaaa aatcgatgcc attgtgcgac tgtgggtacg tcaaactacc cccattatga
      481 ataatttggc aagggattgc tatgaatcga atgaaatagc agatgtggcc tggaaattga
      541 atgtggaaat atcatcgcat tgccagcaaa gggaaaagac agcattagct gtattgcagt
      601 tgaaaactgg tgctggcgag gacataaata tggaaatgaa tcacgaagag ttgttgcaat
      661 tgtatcaaca atttgagtgc atacaaaacg aactagatgc catgaatgca cagccgaaaa
      721 ttgaaactac aaagccagca caaatgtaaa cgtttagtat aaatgaatga tgttttcctc
      781 atgactacag tattatttaa gaaaacatga taactggaaa tgcttatatg ttgttaaatt
      841 ttggatattt ataaaaaaaa agtataaaaa atatatgttt gtgatgttca ctggagtccc
      901 aaaactaa