Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013244425 908 bp mRNA linear INV 02-SEP-2023 (LOC106082098), mRNA. ACCESSION XM_013244425 VERSION XM_013244425.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013244425.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..908 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..908 /gene="LOC106082098" /note="uncharacterized LOC106082098; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106082098" CDS 87..749 /gene="LOC106082098" /codon_start=1 /product="uncharacterized protein LOC106082098" /protein_id="XP_013099879.2" /db_xref="GeneID:106082098" /translation="MSINWIKITDRAREGIKIINALPYNTFSTVLQYVHRQMITTGGG ADSKGENVSSSAENENALEELERLVGVPRPDFLLLIKTFSYILRRTSTYIIKPSLLQT ELRDKLQLQDEAKIDAIVRLWVRQTTPIMNNLARDCYESNEIADVAWKLNVEISSHCQ QREKTALAVLQLKTGAGEDINMEMNHEELLQLYQQFECIQNELDAMNAQPKIETTKPA QM" polyA_site 908 /gene="LOC106082098" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcgtttgttt gttattggtt tgcatgttca ggaagttgtc gtggaaatag ttatcgtgtt 61 tcctttaccg ttacctatag tggacaatga gcattaactg gataaaaata actgatagag 121 ctcgagaggg tataaaaatt ataaatgcct tgccttacaa tacatttagt accgtgcttc 181 aatatgtaca tcgccaaatg attactactg gaggtggtgc agattccaag ggcgagaatg 241 tttcatccag tgccgagaat gaaaatgctt tggaagaatt ggaacgccta gtcggtgtgc 301 cccgtcctga ttttttgttg ttgatcaaaa ctttctccta tatattgagg cgcaccagca 361 catacattat aaaaccttcg ttgcttcaaa cagagctaag ggataagtta caattacaag 421 atgaagcaaa aatcgatgcc attgtgcgac tgtgggtacg tcaaactacc cccattatga 481 ataatttggc aagggattgc tatgaatcga atgaaatagc agatgtggcc tggaaattga 541 atgtggaaat atcatcgcat tgccagcaaa gggaaaagac agcattagct gtattgcagt 601 tgaaaactgg tgctggcgag gacataaata tggaaatgaa tcacgaagag ttgttgcaat 661 tgtatcaaca atttgagtgc atacaaaacg aactagatgc catgaatgca cagccgaaaa 721 ttgaaactac aaagccagca caaatgtaaa cgtttagtat aaatgaatga tgttttcctc 781 atgactacag tattatttaa gaaaacatga taactggaaa tgcttatatg ttgttaaatt 841 ttggatattt ataaaaaaaa agtataaaaa atatatgttt gtgatgttca ctggagtccc 901 aaaactaa