PREDICTED: Stomoxys calcitrans NAD-dependent protein deacylase

LOCUS       XM_013244417            1126 bp    mRNA    linear   INV 02-SEP-2023
            Sirt4 (LOC106082091), mRNA.
ACCESSION   XM_013244417
VERSION     XM_013244417.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244417.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1126
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1126
                     /gene="LOC106082091"
                     /note="NAD-dependent protein deacylase Sirt4; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 15 Proteins"
                     /db_xref="GeneID:106082091"
     CDS             79..1008
                     /gene="LOC106082091"
                     /codon_start=1
                     /product="NAD-dependent protein deacylase Sirt4"
                     /protein_id="XP_013099871.1"
                     /db_xref="GeneID:106082091"
                     /translation="MRFTQILRLRIKCSDLSAAKQQYVPKHQPAVEKDIRKLEDFLMN
                     KPNIVVLTGAGISTESGIPDYRSEGVGLYARSNHKPIQHMEFVRSPSVRQRYWARNFV
                     GWPKFSSTEPNSTHHALSRFEREGRIQCVVTQNVDRLHTKAGTKNVIELHGSGYVVKC
                     LSCDYNIDRHEFQNILNVLNPEFKDAPDMIRPDGDVEIPQEYIDNFRIPPCPKCDDNR
                     LKPEIVFFGDNVPKERVNRIAEMIYAGDGLLVLGSSLLVFSGYRMVLQTKDLNLPVAI
                     VNIGETRADHLADLKLSAKCGDVIPKLFDFKKK"
     misc_feature    190..978
                     /gene="LOC106082091"
                     /note="Eukaryotic and prokaryotic group (class2) which
                     includes human sirtuin SIRT4 and several bacterial
                     homologs; and are members of the SIR2 family of proteins,
                     silent information regulator 2 (Sir2) enzymes which
                     catalyze NAD+-dependent protein/histone...; Region: SIRT4;
                     cd01409"
                     /db_xref="CDD:238700"
     misc_feature    order(241..243,247..252,271..276,424..426,478..483,
                     487..489,532..534,832..834,847..849,913..918,973..975)
                     /gene="LOC106082091"
                     /note="NAD+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238700"
     misc_feature    order(484..486,532..534,748..750,754..768,844..852)
                     /gene="LOC106082091"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238700"
     misc_feature    order(556..558,565..567,709..711,718..720)
                     /gene="LOC106082091"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238700"
     polyA_site      1126
                     /gene="LOC106082091"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatttgttat gtgagtgttt accaaacaag agcccatttt taaacaaagc caaattaagt
       61 acaaagtaaa taacaaatat gcgttttaca caaatacttc gattaaggat aaagtgttca
      121 gatctatcag ctgccaagca gcaatatgtg cctaaacatc aacctgcagt ggagaaagac
      181 ataagaaaat tggaagattt tcttatgaac aagcccaaca tcgtagtatt gacgggtgct
      241 ggaatatcaa cggaatctgg tattcccgat tatcgctcag agggtgttgg tctctacgcg
      301 cgcagtaatc acaaacccat acagcacatg gaatttgtac gctcacccag tgtacgtcaa
      361 cgctattggg ctcgtaattt tgttggctgg cccaaattct catcaacaga gccaaatagt
      421 acccaccatg ccctatcacg atttgaacgc gaaggtcgca tacagtgtgt ggtaacacaa
      481 aatgtcgatc gtttgcatac gaaagcagga accaaaaatg tcatagaact tcacggctct
      541 ggttatgtag tgaaatgcct ttcttgtgat tacaacatcg atcgccatga gtttcagaac
      601 attttgaatg ttttaaatcc cgagtttaag gatgctcctg acatgatacg ccctgacggt
      661 gatgttgaaa ttcctcaaga gtatattgac aacttccgca taccaccttg cccaaaatgt
      721 gatgataatc gtttgaagcc agaaattgta ttttttggcg ataatgtacc caaggaacgt
      781 gtaaatcgta tagcagaaat gatctatgcc ggtgatggtc ttttagtttt gggctcaagt
      841 ttattagtgt tttccggtta tcgcatggtt ttgcaaacaa aagatttaaa tttgccagtg
      901 gccatagtta atataggaga aacaagagcc gatcacttgg ctgatttaaa gttgtcggct
      961 aagtgtggcg atgttatacc caagttattt gatttcaaaa agaaatgata ttatggtggg
     1021 gagtaagaac ataatgccta tttaagaagc ttttagttaa atcaattaaa gagatttgta
     1081 aatatgcttt gtaaccataa taaaaaaatt aatgaaagag ctacaa