Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082068


LOCUS       XM_013244386             621 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082068), mRNA.
ACCESSION   XM_013244386
VERSION     XM_013244386.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244386.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..621
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..621
                     /gene="LOC106082068"
                     /note="uncharacterized LOC106082068; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106082068"
     CDS             141..491
                     /gene="LOC106082068"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082068"
                     /protein_id="XP_013099840.1"
                     /db_xref="GeneID:106082068"
                     /translation="MLKPFITYSLLCGILVLLPFALGKPQDFQTAVLMAAGQVKEAID
                     NGAATRFDKSVEVLGAKFKNNVAAGFGDAMKQKREIASGSATGESLDDSYSESSYEDY
                     SEYYVDDDVEGEKA"
ORIGIN      
        1 aacatgcatg gagaaatgtt aatgaaattt tatataaatt cagaataata aaaaaaaacc
       61 atataagcca aaggacaaca agtgaaaagc gatcaaaata catccaataa taaaataaaa
      121 aaaatctcta aaaaaccaaa atgcttaaac cctttataac ctattccttg ttatgcggaa
      181 ttttggttct acttcccttt gctctaggca agccacagga tttccaaact gctgtcctta
      241 tggctgccgg ccaagttaag gaagccatcg ataatggagc tgccacccgt ttcgataaaa
      301 gtgtggaagt gttgggggcc aaatttaaaa ataatgtggc ggctggtttt ggtgatgcca
      361 tgaaacaaaa acgtgaaatt gcatctggat cagccactgg agaatctttg gacgattctt
      421 atagtgagtc atcgtatgag gactattctg aatattatgt tgatgatgat gtggaagggg
      481 aaaaagcata gggacattaa aggactacta tccaccttaa ggtgttagta tatgcatgca
      541 ttagattagt attattggga aaattatttt aagcaattca tgctttgcaa actaacatgc
      601 agaatagtaa taaagaatta a