Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013244386 621 bp mRNA linear INV 02-SEP-2023 (LOC106082068), mRNA. ACCESSION XM_013244386 VERSION XM_013244386.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013244386.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..621 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..621 /gene="LOC106082068" /note="uncharacterized LOC106082068; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106082068" CDS 141..491 /gene="LOC106082068" /codon_start=1 /product="uncharacterized protein LOC106082068" /protein_id="XP_013099840.1" /db_xref="GeneID:106082068" /translation="MLKPFITYSLLCGILVLLPFALGKPQDFQTAVLMAAGQVKEAID NGAATRFDKSVEVLGAKFKNNVAAGFGDAMKQKREIASGSATGESLDDSYSESSYEDY SEYYVDDDVEGEKA" ORIGIN 1 aacatgcatg gagaaatgtt aatgaaattt tatataaatt cagaataata aaaaaaaacc 61 atataagcca aaggacaaca agtgaaaagc gatcaaaata catccaataa taaaataaaa 121 aaaatctcta aaaaaccaaa atgcttaaac cctttataac ctattccttg ttatgcggaa 181 ttttggttct acttcccttt gctctaggca agccacagga tttccaaact gctgtcctta 241 tggctgccgg ccaagttaag gaagccatcg ataatggagc tgccacccgt ttcgataaaa 301 gtgtggaagt gttgggggcc aaatttaaaa ataatgtggc ggctggtttt ggtgatgcca 361 tgaaacaaaa acgtgaaatt gcatctggat cagccactgg agaatctttg gacgattctt 421 atagtgagtc atcgtatgag gactattctg aatattatgt tgatgatgat gtggaagggg 481 aaaaagcata gggacattaa aggactacta tccaccttaa ggtgttagta tatgcatgca 541 ttagattagt attattggga aaattatttt aagcaattca tgctttgcaa actaacatgc 601 agaatagtaa taaagaatta a