Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013244359 994 bp mRNA linear INV 02-SEP-2023 (LOC106082048), mRNA. ACCESSION XM_013244359 VERSION XM_013244359.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013244359.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..994 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..994 /gene="LOC106082048" /note="uncharacterized LOC106082048; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106082048" CDS 210..962 /gene="LOC106082048" /codon_start=1 /product="uncharacterized protein LOC106082048" /protein_id="XP_013099813.2" /db_xref="GeneID:106082048" /translation="MKMSWGNDKRRVILTQVLSTTFVTMLMVMLMEVSFFTLMTGQVT ALKINKDYTKRLVMAPAEANETFENGEGFDHNAAFENDAATSVEEAVLDNEQAADNDQ AFDNDSTPPQDEAALDNDSTFDNEIATPQDEAGFDNVATFDNDSNPPQDDVEAPIVKT EVLIFVSPIKMDAEFGDVRRDRRASKSTSPTKSQSSSESASGSESDSGSVSSSSSSSA SATDSGSESEYELEIESETASEASLIEESNRD" ORIGIN 1 cagtggcagg aaataattaa gagttaactt caaaaaaaag agcacaacaa ctacaaccac 61 agtgacagga taaaggaaac agctgaaaca taagaccatc ataaaataat tggacaataa 121 ctgattactg cgttagtgaa aaaacaaaac ggatttctat aaaatttgtt agctttttcg 181 cagctggaaa agaaaccaat tgtttggcca tgaaaatgag ttggggaaat gataagagaa 241 gggtcatttt aacccaagtc ttaagcacaa cgtttgtcac catgctgatg gtaatgctaa 301 tggaagtcag cttctttaca ttaatgacag ggcaggtaac agccttaaaa ataaacaagg 361 attatacaaa acgtcttgta atggctccag ccgaagccaa tgaaactttt gagaatggtg 421 aaggctttga ccataatgct gcttttgaga acgatgctgc cacttcagta gaagaagctg 481 ttcttgacaa tgagcaggct gctgataatg atcaagcttt tgacaatgat tctacccctc 541 ctcaagatga ggctgccctt gacaatgatt caactttcga caatgaaatt gccactccac 601 aagatgaagc tggctttgac aatgttgcaa ccttcgacaa tgattctaac ccaccacaag 661 atgacgttga agctcccata gtaaaaactg aagttttaat ttttgtgtct cccattaaaa 721 tggatgctga attcggtgat gttagaagag atagacgtgc aagcaaatca acatcaccaa 781 caaagtctca atcgagttct gagtctgctt ctggatcaga gtcagattca ggatctgttt 841 ccagttctag ttctagctca gcatctgcaa ctgactctgg atcagagagc gagtatgagt 901 tagaaataga atctgaaact gcatctgaag cgtctctaat tgaggagtca aatagggatt 961 gacgtcttcg cgaaatattt gtagaacttt tgaa