Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106082048


LOCUS       XM_013244359             994 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106082048), mRNA.
ACCESSION   XM_013244359
VERSION     XM_013244359.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244359.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..994
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..994
                     /gene="LOC106082048"
                     /note="uncharacterized LOC106082048; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106082048"
     CDS             210..962
                     /gene="LOC106082048"
                     /codon_start=1
                     /product="uncharacterized protein LOC106082048"
                     /protein_id="XP_013099813.2"
                     /db_xref="GeneID:106082048"
                     /translation="MKMSWGNDKRRVILTQVLSTTFVTMLMVMLMEVSFFTLMTGQVT
                     ALKINKDYTKRLVMAPAEANETFENGEGFDHNAAFENDAATSVEEAVLDNEQAADNDQ
                     AFDNDSTPPQDEAALDNDSTFDNEIATPQDEAGFDNVATFDNDSNPPQDDVEAPIVKT
                     EVLIFVSPIKMDAEFGDVRRDRRASKSTSPTKSQSSSESASGSESDSGSVSSSSSSSA
                     SATDSGSESEYELEIESETASEASLIEESNRD"
ORIGIN      
        1 cagtggcagg aaataattaa gagttaactt caaaaaaaag agcacaacaa ctacaaccac
       61 agtgacagga taaaggaaac agctgaaaca taagaccatc ataaaataat tggacaataa
      121 ctgattactg cgttagtgaa aaaacaaaac ggatttctat aaaatttgtt agctttttcg
      181 cagctggaaa agaaaccaat tgtttggcca tgaaaatgag ttggggaaat gataagagaa
      241 gggtcatttt aacccaagtc ttaagcacaa cgtttgtcac catgctgatg gtaatgctaa
      301 tggaagtcag cttctttaca ttaatgacag ggcaggtaac agccttaaaa ataaacaagg
      361 attatacaaa acgtcttgta atggctccag ccgaagccaa tgaaactttt gagaatggtg
      421 aaggctttga ccataatgct gcttttgaga acgatgctgc cacttcagta gaagaagctg
      481 ttcttgacaa tgagcaggct gctgataatg atcaagcttt tgacaatgat tctacccctc
      541 ctcaagatga ggctgccctt gacaatgatt caactttcga caatgaaatt gccactccac
      601 aagatgaagc tggctttgac aatgttgcaa ccttcgacaa tgattctaac ccaccacaag
      661 atgacgttga agctcccata gtaaaaactg aagttttaat ttttgtgtct cccattaaaa
      721 tggatgctga attcggtgat gttagaagag atagacgtgc aagcaaatca acatcaccaa
      781 caaagtctca atcgagttct gagtctgctt ctggatcaga gtcagattca ggatctgttt
      841 ccagttctag ttctagctca gcatctgcaa ctgactctgg atcagagagc gagtatgagt
      901 tagaaataga atctgaaact gcatctgaag cgtctctaat tgaggagtca aatagggatt
      961 gacgtcttcg cgaaatattt gtagaacttt tgaa