Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome c oxidase subunit 5B,


LOCUS       XM_013244288             655 bp    mRNA    linear   INV 02-SEP-2023
            mitochondrial-like (LOC106081995), mRNA.
ACCESSION   XM_013244288
VERSION     XM_013244288.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013244288.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..655
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..655
                     /gene="LOC106081995"
                     /note="cytochrome c oxidase subunit 5B,
                     mitochondrial-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:106081995"
     CDS             87..449
                     /gene="LOC106081995"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 5B,
                     mitochondrial-like"
                     /protein_id="XP_013099742.2"
                     /db_xref="GeneID:106081995"
                     /translation="MALYFRKILLEIPALKRCISASQKLFKKLPDPLELCTGQQKKEI
                     LAFMEGNCDPYHMAVIKRGSGTKDNPTLIPSAFNGRIVGCICNDNRFVNYMWLEKDCP
                     KRCECGHWFKLKEVKAFS"
     polyA_site      655
                     /gene="LOC106081995"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agtagacata tttcggtaaa gttgtctgtc agaattaatt ttcttatcga caattggagt
       61 tttagttgaa atattttcct cataaaatgg ctttgtattt tcgtaagatt ttgcttgaaa
      121 tacctgcgct caaaagatgt atatctgcaa gtcaaaaact ctttaagaaa cttccagatc
      181 ctcttgagct ctgtacggga caacaaaaga aggaaatttt agcttttatg gaaggaaatt
      241 gtgatcctta tcacatggcg gttataaaaa ggggtagtgg tactaaggat aatcccactt
      301 taattccatc agcattcaat ggacgcattg ttggttgtat ttgcaatgac aatcgtttcg
      361 tcaattacat gtggctggaa aaagattgtc ccaagcgctg tgaatgtggt cactggttta
      421 aactaaagga agttaaagct ttttcgtaaa tgtggccaat aatttgatga aagaataatt
      481 gttgaaggaa tttcctcaaa tgtccatggt cacaagtcag ctgtaacatt attgtctaat
      541 ttacctttgt atgtgtaaat ttttgatgaa attttctata aaataaaatt tcgactaaaa
      601 tttttctaaa atataacaaa taaaagttcg accgggtcga atcttgggaa cccca