Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013244288 655 bp mRNA linear INV 02-SEP-2023 mitochondrial-like (LOC106081995), mRNA. ACCESSION XM_013244288 VERSION XM_013244288.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013244288.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..655 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..655 /gene="LOC106081995" /note="cytochrome c oxidase subunit 5B, mitochondrial-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106081995" CDS 87..449 /gene="LOC106081995" /codon_start=1 /product="cytochrome c oxidase subunit 5B, mitochondrial-like" /protein_id="XP_013099742.2" /db_xref="GeneID:106081995" /translation="MALYFRKILLEIPALKRCISASQKLFKKLPDPLELCTGQQKKEI LAFMEGNCDPYHMAVIKRGSGTKDNPTLIPSAFNGRIVGCICNDNRFVNYMWLEKDCP KRCECGHWFKLKEVKAFS" polyA_site 655 /gene="LOC106081995" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agtagacata tttcggtaaa gttgtctgtc agaattaatt ttcttatcga caattggagt 61 tttagttgaa atattttcct cataaaatgg ctttgtattt tcgtaagatt ttgcttgaaa 121 tacctgcgct caaaagatgt atatctgcaa gtcaaaaact ctttaagaaa cttccagatc 181 ctcttgagct ctgtacggga caacaaaaga aggaaatttt agcttttatg gaaggaaatt 241 gtgatcctta tcacatggcg gttataaaaa ggggtagtgg tactaaggat aatcccactt 301 taattccatc agcattcaat ggacgcattg ttggttgtat ttgcaatgac aatcgtttcg 361 tcaattacat gtggctggaa aaagattgtc ccaagcgctg tgaatgtggt cactggttta 421 aactaaagga agttaaagct ttttcgtaaa tgtggccaat aatttgatga aagaataatt 481 gttgaaggaa tttcctcaaa tgtccatggt cacaagtcag ctgtaacatt attgtctaat 541 ttacctttgt atgtgtaaat ttttgatgaa attttctata aaataaaatt tcgactaaaa 601 tttttctaaa atataacaaa taaaagttcg accgggtcga atcttgggaa cccca