Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106081775


LOCUS       XM_013243972             839 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081775), mRNA.
ACCESSION   XM_013243972
VERSION     XM_013243972.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243972.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..839
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..839
                     /gene="LOC106081775"
                     /note="uncharacterized LOC106081775; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106081775"
     CDS             196..729
                     /gene="LOC106081775"
                     /codon_start=1
                     /product="uncharacterized protein LOC106081775"
                     /protein_id="XP_013099426.2"
                     /db_xref="GeneID:106081775"
                     /translation="MFKIHFNFVLSVLVMLWLGTHAISATSIAKRSIPLTNPKATEGE
                     VQLRDVVTIKDIRAFVAEHPNLHLTRLMKKERQSTLQTVKYTLGGRVSGDRLVAQYGD
                     TTFYPVKKDVTTQVTYPATGTGSVVTAVEIHCLQDENNGNAYVVAGGLGQRFISIVLE
                     AVQTERFTYNIHVYGTD"
     polyA_site      839
                     /gene="LOC106081775"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gatttagttt gaattcaaac attgaaacgg aaattagaaa cgcgaatcgc caaaaccagc
       61 aaatcctaag ctgaccatct tacctgtaac ataaatctac tctggaaagg aaatacctgt
      121 attgagagag tgtgtgtgtg tgtgcgtgtg tgtgaagaat cactctttcg tcgaaaaaac
      181 caaaaaaaaa aaaaaatgtt taaaattcat ttcaattttg ttttgtctgt cctggtcatg
      241 ttgtggctgg gcactcatgc catttccgcc acgtctatag ccaaaagatc tattcctcta
      301 acaaatccaa aagctactga gggtgaggtg cagttacgag atgttgtaac gataaaggat
      361 attcgcgcct tcgtagccga acatcctaat ttgcatttga cccgcctaat gaaaaaggag
      421 cgccaaagta ctttgcaaac tgtgaagtac actttgggcg gtcgtgtatc aggcgatcgt
      481 ctggtggctc aatatggtga taccaccttc tatccggtta aaaaagatgt taccacacaa
      541 gtgacctatc ctgcaactgg caccggcagt gtggtcactg ccgtcgaaat ccattgtttg
      601 caagatgaaa acaatggcaa tgcttatgtg gtggccggag gattgggtca gcgtttcatt
      661 tccatagtgc tggaggcagt gcaaacagaa cgtttcactt acaacatcca tgtttatggc
      721 actgactaag cttgagagga gatgagcagc aaaacaaaaa ggagaaggaa gagtcaaagg
      781 agtatgcaaa acttgaaata gcaacaaata ggaaaaaaat attttttgaa agagataaa