Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243972 839 bp mRNA linear INV 02-SEP-2023 (LOC106081775), mRNA. ACCESSION XM_013243972 VERSION XM_013243972.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243972.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..839 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..839 /gene="LOC106081775" /note="uncharacterized LOC106081775; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106081775" CDS 196..729 /gene="LOC106081775" /codon_start=1 /product="uncharacterized protein LOC106081775" /protein_id="XP_013099426.2" /db_xref="GeneID:106081775" /translation="MFKIHFNFVLSVLVMLWLGTHAISATSIAKRSIPLTNPKATEGE VQLRDVVTIKDIRAFVAEHPNLHLTRLMKKERQSTLQTVKYTLGGRVSGDRLVAQYGD TTFYPVKKDVTTQVTYPATGTGSVVTAVEIHCLQDENNGNAYVVAGGLGQRFISIVLE AVQTERFTYNIHVYGTD" polyA_site 839 /gene="LOC106081775" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gatttagttt gaattcaaac attgaaacgg aaattagaaa cgcgaatcgc caaaaccagc 61 aaatcctaag ctgaccatct tacctgtaac ataaatctac tctggaaagg aaatacctgt 121 attgagagag tgtgtgtgtg tgtgcgtgtg tgtgaagaat cactctttcg tcgaaaaaac 181 caaaaaaaaa aaaaaatgtt taaaattcat ttcaattttg ttttgtctgt cctggtcatg 241 ttgtggctgg gcactcatgc catttccgcc acgtctatag ccaaaagatc tattcctcta 301 acaaatccaa aagctactga gggtgaggtg cagttacgag atgttgtaac gataaaggat 361 attcgcgcct tcgtagccga acatcctaat ttgcatttga cccgcctaat gaaaaaggag 421 cgccaaagta ctttgcaaac tgtgaagtac actttgggcg gtcgtgtatc aggcgatcgt 481 ctggtggctc aatatggtga taccaccttc tatccggtta aaaaagatgt taccacacaa 541 gtgacctatc ctgcaactgg caccggcagt gtggtcactg ccgtcgaaat ccattgtttg 601 caagatgaaa acaatggcaa tgcttatgtg gtggccggag gattgggtca gcgtttcatt 661 tccatagtgc tggaggcagt gcaaacagaa cgtttcactt acaacatcca tgtttatggc 721 actgactaag cttgagagga gatgagcagc aaaacaaaaa ggagaaggaa gagtcaaagg 781 agtatgcaaa acttgaaata gcaacaaata ggaaaaaaat attttttgaa agagataaa