Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans trypsin delta (LOC106081612), mRNA.


LOCUS       XM_013243705            1192 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013243705
VERSION     XM_013243705.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243705.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1192
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1192
                     /gene="LOC106081612"
                     /note="trypsin delta; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 10 Proteins"
                     /db_xref="GeneID:106081612"
     CDS             178..1137
                     /gene="LOC106081612"
                     /codon_start=1
                     /product="trypsin delta"
                     /protein_id="XP_013099159.1"
                     /db_xref="GeneID:106081612"
                     /translation="MHTKVIISVLVLLNLCVNIMATSPTTAKKEKEVEKDPRIIGGQA
                     ISIQMAPWQVSVRLKVYEAEMYGYGHICGGSVISQRVVVTAAHCILNQNVNPMAYRSP
                     NEFTLVMGSAYLYQIPPYTLQYDVLQIAVHLGFNLNTMQNDVAMFVINGYIPWSWPTV
                     QAIPLNTVAEPNGTYCTVSGWGKTSLNTDIVSSILMEATVPIVGYATCDINYGNISTG
                     MLCAGYMTTGGVDACQGDSGGPLVCNGYLAGIVSWGYSCAQPGYPGIYTNVSFYDNWI
                     VTNNQSFNYSLYYNNGNAVKVTYGLSALLSLSVFLILAKYLQI"
     misc_feature    289..1005
                     /gene="LOC106081612"
                     /note="Trypsin-like serine protease; Region: Tryp_SPc;
                     smart00020"
                     /db_xref="CDD:214473"
     misc_feature    292..294
                     /gene="LOC106081612"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(436..438,604..606,886..888)
                     /gene="LOC106081612"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(868..870,931..933,937..939)
                     /gene="LOC106081612"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
ORIGIN      
        1 tacttgaaac tcagttttcc cggggcacgt taaaagatat gaaattcgaa attgacaacg
       61 gtcggttcgt tggaggaata aatcaagaaa aactaacttt gaattttggc taaaggcaaa
      121 attaaataat caaaatttta ttaaatatta aatagcaaaa ataaaactta taaaacaatg
      181 catactaaag tgatcatttc ggtgttagtt ttactcaatt tgtgtgtaaa tataatggca
      241 acatctccca ccactgcaaa aaaggaaaag gaagtggaaa aagatccccg cattattggc
      301 ggccaagcga tctccataca aatggcccct tggcaggtgt cggtacgcct aaaggtctac
      361 gaagcggaga tgtatggcta tggccacata tgcgggggat cggtgatatc gcaacgtgtt
      421 gtagtgacgg cagctcattg tatactcaat caaaatgtta atcccatggc ttaccgcagt
      481 cccaatgaat ttactttggt aatgggctct gcttatctat atcaaattcc cccttacact
      541 ctgcaatatg atgtgctgca aattgccgtt catctaggat tcaatttgaa caccatgcaa
      601 aatgatgtgg ccatgtttgt gataaatggc tatataccgt ggtcatggcc cacagtgcaa
      661 gcgataccct tgaataccgt tgccgaaccg aatggtacat attgcacagt ctccggctgg
      721 ggtaaaacca gtttgaacac cgacatagtt tcgagcatac ttatggaggc cactgtaccc
      781 attgtgggct atgccacatg tgatatcaac tatggcaaca ttagcacggg catgttgtgt
      841 gctggctaca tgaccacagg cggtgtggat gcctgtcaag gtgattctgg tggacccttg
      901 gtatgcaatg gttacttggc tggcatagtt tcctggggtt atagctgcgc tcagcctgga
      961 tatcctggca tttatacaaa tgtctccttc tatgacaatt ggattgtaac caataatcaa
     1021 tcgttcaact atagtttata ttacaacaat ggaaatgctg taaaggtgac ttacgggcta
     1081 agtgccctat tgagcctgag tgtttttctt atcttggcaa aatatttaca aatataatat
     1141 ttccttataa gatgagtgtt ttaatagaaa tatttttgaa ttgccatagt tt