Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243665 930 bp mRNA linear INV 02-SEP-2023 transcription subunit 20 (LOC106081593), mRNA. ACCESSION XM_013243665 VERSION XM_013243665.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243665.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..930 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..930 /gene="LOC106081593" /note="mediator of RNA polymerase II transcription subunit 20; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106081593" CDS 125..841 /gene="LOC106081593" /codon_start=1 /product="mediator of RNA polymerase II transcription subunit 20" /protein_id="XP_013099119.1" /db_xref="GeneID:106081593" /translation="MGVTVLQPYQIPEGKTGAQAIDFLTKRLLALGAVHTGQFLVDCE TYISVSPHGPTKSVHALHNSEYPVTTFSILDTGTGKQIPLVADNLFDMLMLKMINVST HKKQTKIESKGARFEYGDFLIKLGSVTMSENFKGILIEIEYRPCVVLFYCWEMIREVL QSFLGVTVPKEYPSYFTPQQVVNAMGQQQLHAKQNDIYEPIDTINQYLEHFTNYRKQN MPQVSQSSSTMSMNTGMRVP" misc_feature 125..760 /gene="LOC106081593" /note="TATA-binding related factor (TRF) of subunit 20 of Mediator complex; Region: Med20; pfam08612" /db_xref="CDD:400779" polyA_site 930 /gene="LOC106081593" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tacgtttttt ttaattgtaa ttatctacat tggccatttt tgtggctttt tgttacatgt 61 tctgaatgaa taaataaata aatgctattt actgtctaaa aaagatatca aaactaataa 121 ccaaatggga gttaccgtgc tacaaccata tcaaataccg gaaggaaaaa ctggagctca 181 agccattgat ttcttgacaa agcgtctgct cgctttggga gctgtgcaca ccggtcaatt 241 tctggtggat tgtgaaacct atatatctgt ttcaccccat ggcccaacca aatcggtgca 301 tgctcttcat aattccgaat atcctgtcac cacattttcc atattggaca ctggcactgg 361 taaacaaatt ccccttgttg cagataattt gtttgacatg ctgatgctga aaatgatcaa 421 tgtttctacg cacaaaaagc aaaccaaaat tgaatcaaaa ggagccaggt ttgaatatgg 481 agatttccta attaaacttg gttcggttac aatgtcggaa aatttcaaag gtattctcat 541 cgaaattgaa tatagaccct gtgttgtact cttctattgt tgggaaatga taagagaagt 601 gttgcaaagt ttccttggag ttacagtgcc caaggagtac ccttcatatt ttacaccgca 661 acaagtagtt aatgccatgg gacagcagca gttgcatgca aaacagaatg acatatatga 721 acccattgat acgataaatc aatatttgga acattttacc aattaccgca aacaaaatat 781 gccccaggtt tctcaatcgt cgtcgactat gtcaatgaac actggaatga gagtgccgta 841 attagcagat ttatgttatt aaatatttat attgtagata gtcgaacaga aaaataaaat 901 atatatttat atttgcttaa aagtaaataa