Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mediator of RNA polymerase II


LOCUS       XM_013243665             930 bp    mRNA    linear   INV 02-SEP-2023
            transcription subunit 20 (LOC106081593), mRNA.
ACCESSION   XM_013243665
VERSION     XM_013243665.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243665.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..930
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..930
                     /gene="LOC106081593"
                     /note="mediator of RNA polymerase II transcription subunit
                     20; Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 7 Proteins"
                     /db_xref="GeneID:106081593"
     CDS             125..841
                     /gene="LOC106081593"
                     /codon_start=1
                     /product="mediator of RNA polymerase II transcription
                     subunit 20"
                     /protein_id="XP_013099119.1"
                     /db_xref="GeneID:106081593"
                     /translation="MGVTVLQPYQIPEGKTGAQAIDFLTKRLLALGAVHTGQFLVDCE
                     TYISVSPHGPTKSVHALHNSEYPVTTFSILDTGTGKQIPLVADNLFDMLMLKMINVST
                     HKKQTKIESKGARFEYGDFLIKLGSVTMSENFKGILIEIEYRPCVVLFYCWEMIREVL
                     QSFLGVTVPKEYPSYFTPQQVVNAMGQQQLHAKQNDIYEPIDTINQYLEHFTNYRKQN
                     MPQVSQSSSTMSMNTGMRVP"
     misc_feature    125..760
                     /gene="LOC106081593"
                     /note="TATA-binding related factor (TRF) of subunit 20 of
                     Mediator complex; Region: Med20; pfam08612"
                     /db_xref="CDD:400779"
     polyA_site      930
                     /gene="LOC106081593"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tacgtttttt ttaattgtaa ttatctacat tggccatttt tgtggctttt tgttacatgt
       61 tctgaatgaa taaataaata aatgctattt actgtctaaa aaagatatca aaactaataa
      121 ccaaatggga gttaccgtgc tacaaccata tcaaataccg gaaggaaaaa ctggagctca
      181 agccattgat ttcttgacaa agcgtctgct cgctttggga gctgtgcaca ccggtcaatt
      241 tctggtggat tgtgaaacct atatatctgt ttcaccccat ggcccaacca aatcggtgca
      301 tgctcttcat aattccgaat atcctgtcac cacattttcc atattggaca ctggcactgg
      361 taaacaaatt ccccttgttg cagataattt gtttgacatg ctgatgctga aaatgatcaa
      421 tgtttctacg cacaaaaagc aaaccaaaat tgaatcaaaa ggagccaggt ttgaatatgg
      481 agatttccta attaaacttg gttcggttac aatgtcggaa aatttcaaag gtattctcat
      541 cgaaattgaa tatagaccct gtgttgtact cttctattgt tgggaaatga taagagaagt
      601 gttgcaaagt ttccttggag ttacagtgcc caaggagtac ccttcatatt ttacaccgca
      661 acaagtagtt aatgccatgg gacagcagca gttgcatgca aaacagaatg acatatatga
      721 acccattgat acgataaatc aatatttgga acattttacc aattaccgca aacaaaatat
      781 gccccaggtt tctcaatcgt cgtcgactat gtcaatgaac actggaatga gagtgccgta
      841 attagcagat ttatgttatt aaatatttat attgtagata gtcgaacaga aaaataaaat
      901 atatatttat atttgcttaa aagtaaataa