Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans adenosine 5'-monophosphoramidase


LOCUS       XM_013243351             594 bp    mRNA    linear   INV 02-SEP-2023
            HINT1 (LOC106081419), mRNA.
ACCESSION   XM_013243351
VERSION     XM_013243351.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..594
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..594
                     /gene="LOC106081419"
                     /note="adenosine 5'-monophosphoramidase HINT1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 16 Proteins"
                     /db_xref="GeneID:106081419"
     CDS             54..524
                     /gene="LOC106081419"
                     /codon_start=1
                     /product="adenosine 5'-monophosphoramidase HINT1"
                     /protein_id="XP_013098805.1"
                     /db_xref="GeneID:106081419"
                     /translation="MTLLRLHSLCRVILRNSWTKTSTATTPLRVMSSEVDKAQAAAPS
                     EDTIFGKILRKEIPCNFIYEDDKCVAFHDIMAQAPTHFLVIPRKPIAMLSNATEEDES
                     LLGHLMLVGSKVAKDLGLEQGYRVVINNGKDGAQSVYHLHLHFLGGRQMKWPPG"
     misc_feature    189..497
                     /gene="LOC106081419"
                     /note="Protein Kinase C Interacting protein related
                     (PKCI): PKCI and related proteins belong to the ubiquitous
                     HIT family of hydrolases that act on alpha-phosphates of
                     ribonucleotides. The members of this subgroup have a
                     conserved HxHxHxx motif (x is a...; Region: PKCI_related;
                     cd01276"
                     /db_xref="CDD:238607"
     misc_feature    order(264..266,270..275,294..296,300..302,438..440,
                     459..461,465..467,477..479,483..485)
                     /gene="LOC106081419"
                     /note="nucleotide binding site/active site [active]"
                     /db_xref="CDD:238607"
     misc_feature    order(471..473,477..479,483..491)
                     /gene="LOC106081419"
                     /note="HIT family signature motif [active]"
                     /db_xref="CDD:238607"
     misc_feature    477..479
                     /gene="LOC106081419"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238607"
     polyA_site      594
                     /gene="LOC106081419"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgaatagatt attgtcaaat aaaacacgcc taatatctaa aacagtttga cagatgacgc
       61 tgttgaggtt acattcactt tgtcgagtga ttttaagaaa ttcttggacg aaaacatcca
      121 cagcaacaac accattaagg gtaatgtcaa gtgaggttga taaggcccag gcggcagcgc
      181 cgtctgaaga cacaatcttc ggaaaaattc ttcgcaaaga aattccatgc aattttattt
      241 acgaggatga caaatgtgtg gcctttcatg atattatggc tcaggcccct acgcacttct
      301 tggtgattcc tcgcaaacct attgcaatgc tgtctaatgc taccgaagag gatgaatccc
      361 tattgggcca tctgatgctg gttggtagta aagttgctaa agatttgggc ctagaacaag
      421 gatatcgtgt ggtcattaac aacggcaaag atggagctca atctgtttac catttgcatt
      481 tacatttcct aggtggtcgt caaatgaaat ggccaccagg ttaggacccc aataccaatt
      541 tgtcaagctt tattattctg cttgtttaaa ataaataagc tgttgaaaat gcaa