Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243351 594 bp mRNA linear INV 02-SEP-2023 HINT1 (LOC106081419), mRNA. ACCESSION XM_013243351 VERSION XM_013243351.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..594 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..594 /gene="LOC106081419" /note="adenosine 5'-monophosphoramidase HINT1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:106081419" CDS 54..524 /gene="LOC106081419" /codon_start=1 /product="adenosine 5'-monophosphoramidase HINT1" /protein_id="XP_013098805.1" /db_xref="GeneID:106081419" /translation="MTLLRLHSLCRVILRNSWTKTSTATTPLRVMSSEVDKAQAAAPS EDTIFGKILRKEIPCNFIYEDDKCVAFHDIMAQAPTHFLVIPRKPIAMLSNATEEDES LLGHLMLVGSKVAKDLGLEQGYRVVINNGKDGAQSVYHLHLHFLGGRQMKWPPG" misc_feature 189..497 /gene="LOC106081419" /note="Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a...; Region: PKCI_related; cd01276" /db_xref="CDD:238607" misc_feature order(264..266,270..275,294..296,300..302,438..440, 459..461,465..467,477..479,483..485) /gene="LOC106081419" /note="nucleotide binding site/active site [active]" /db_xref="CDD:238607" misc_feature order(471..473,477..479,483..491) /gene="LOC106081419" /note="HIT family signature motif [active]" /db_xref="CDD:238607" misc_feature 477..479 /gene="LOC106081419" /note="catalytic residue [active]" /db_xref="CDD:238607" polyA_site 594 /gene="LOC106081419" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgaatagatt attgtcaaat aaaacacgcc taatatctaa aacagtttga cagatgacgc 61 tgttgaggtt acattcactt tgtcgagtga ttttaagaaa ttcttggacg aaaacatcca 121 cagcaacaac accattaagg gtaatgtcaa gtgaggttga taaggcccag gcggcagcgc 181 cgtctgaaga cacaatcttc ggaaaaattc ttcgcaaaga aattccatgc aattttattt 241 acgaggatga caaatgtgtg gcctttcatg atattatggc tcaggcccct acgcacttct 301 tggtgattcc tcgcaaacct attgcaatgc tgtctaatgc taccgaagag gatgaatccc 361 tattgggcca tctgatgctg gttggtagta aagttgctaa agatttgggc ctagaacaag 421 gatatcgtgt ggtcattaac aacggcaaag atggagctca atctgtttac catttgcatt 481 tacatttcct aggtggtcgt caaatgaaat ggccaccagg ttaggacccc aataccaatt 541 tgtcaagctt tattattctg cttgtttaaa ataaataagc tgttgaaaat gcaa