Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans selenoprotein BthD (LOC106081412),


LOCUS       XM_013243335             609 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013243335
VERSION     XM_013243335.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243335.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..609
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..609
                     /gene="LOC106081412"
                     /note="selenoprotein BthD; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106081412"
     CDS             82..483
                     /gene="LOC106081412"
                     /codon_start=1
                     /product="selenoprotein BthD"
                     /protein_id="XP_013098789.2"
                     /db_xref="GeneID:106081412"
                     /translation="MPKIKSKKGQREVDWSSDVHFQKTRSIVYIEHTHECPIFAIKAE
                     EFLKFLQSQISTRQFVLIRNGYGKIEPRPGSFEIEFSQNARTSRHNLWSGLDKGPPRR
                     DKFPNFESLMPAIHKILKKFYPDVVQRGEDD"
     polyA_site      609
                     /gene="LOC106081412"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taaagagaaa acaaaataat aaacaaaaat ttaagtactg aacaaaaaat aaaaattttc
       61 tgttaaaaaa aaatctcaaa aatgcccaaa ataaaatcca agaaaggtca acgggaagtg
      121 gactggtctt cggatgtcca ttttcaaaag actcgttcca ttgtctatat cgaacacacc
      181 catgaatgtc ccatattcgc cattaaagct gaggagtttc ttaaatttct tcaatctcaa
      241 atatcaacaa ggcaatttgt tttaatacgc aatggctatg gaaaaattga gcctcgtccg
      301 ggttcattcg aaatagagtt ttcccaaaat gctcgtacct caagacataa tctatggtcc
      361 ggtttagata agggtccacc gagacgggat aagtttccca attttgaaag tcttatgccg
      421 gcaatacaca aaattttaaa gaaattctat ccggatgtgg tgcaaagagg cgaagatgat
      481 taatgcaaat gtggaaattt gaggttggaa tgacaatgag gtcctcgcat tgttttgggt
      541 actgaacaat tttaagttga ttgttgctta taaaatcctg tatatcgaat aaagacaaaa
      601 caattatta