Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243335 609 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013243335 VERSION XM_013243335.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243335.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..609 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..609 /gene="LOC106081412" /note="selenoprotein BthD; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106081412" CDS 82..483 /gene="LOC106081412" /codon_start=1 /product="selenoprotein BthD" /protein_id="XP_013098789.2" /db_xref="GeneID:106081412" /translation="MPKIKSKKGQREVDWSSDVHFQKTRSIVYIEHTHECPIFAIKAE EFLKFLQSQISTRQFVLIRNGYGKIEPRPGSFEIEFSQNARTSRHNLWSGLDKGPPRR DKFPNFESLMPAIHKILKKFYPDVVQRGEDD" polyA_site 609 /gene="LOC106081412" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taaagagaaa acaaaataat aaacaaaaat ttaagtactg aacaaaaaat aaaaattttc 61 tgttaaaaaa aaatctcaaa aatgcccaaa ataaaatcca agaaaggtca acgggaagtg 121 gactggtctt cggatgtcca ttttcaaaag actcgttcca ttgtctatat cgaacacacc 181 catgaatgtc ccatattcgc cattaaagct gaggagtttc ttaaatttct tcaatctcaa 241 atatcaacaa ggcaatttgt tttaatacgc aatggctatg gaaaaattga gcctcgtccg 301 ggttcattcg aaatagagtt ttcccaaaat gctcgtacct caagacataa tctatggtcc 361 ggtttagata agggtccacc gagacgggat aagtttccca attttgaaag tcttatgccg 421 gcaatacaca aaattttaaa gaaattctat ccggatgtgg tgcaaagagg cgaagatgat 481 taatgcaaat gtggaaattt gaggttggaa tgacaatgag gtcctcgcat tgttttgggt 541 actgaacaat tttaagttga ttgttgctta taaaatcctg tatatcgaat aaagacaaaa 601 caattatta