Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans TNF receptor-associated factor 3


LOCUS       XM_013243203            1607 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081315), mRNA.
ACCESSION   XM_013243203
VERSION     XM_013243203.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243203.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1607
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1607
                     /gene="LOC106081315"
                     /note="TNF receptor-associated factor 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:106081315"
     CDS             196..1587
                     /gene="LOC106081315"
                     /codon_start=1
                     /product="TNF receptor-associated factor 3"
                     /protein_id="XP_013098657.2"
                     /db_xref="GeneID:106081315"
                     /translation="MNGTSINNGDSATPPSSPGSTTVVKYEKSSCLFCNEWFDSQTFT
                     EHLIHCGQVLEQCPNTCNVFVPRIRMRAHLKECPRNKRRSTSLERVDHQIDTRVQVLE
                     NEINTLRSVLNEEIRQRLHLITDVGNLRKQNQIIDDWQHSTNQNVKALQLRLDEENNQ
                     RTFEVEQCQQDFRCSFDTIQALKTEIRHEIDDLEKHINQMSLDLTQHQNHLNDNIMKL
                     EETVLLHEKINRDKFIEVENFLQAINVDLNTKLSSGNDGGKYAALDVEVKSMKHMVCE
                     TEERCDKLETLVGQIDRSLHHTMQLVNDCENHIATQQRLTSYINCRGHLVWRIKNFSK
                     KLEEARQYDTILHSAMFSNKPFGYALRLDIYLNGKGTWKGRNMIACLNVIAGEYDPLL
                     PWPCRLQADVIIRDQTLNQLEPDDYVKTVLVRKKSDDYIQTKQFFHISHSILTQSRYV
                     KNDSIFVEVKIVK"
ORIGIN      
        1 tgcaaaaaat tcaatccttt tcaaactaac ttgaatctat catggacagc ctacaaaaac
       61 aattctaagt tatcaattgt gatcgttatc attacgtata ctgaccacat ctaaaaaagt
      121 gttgccttag tctttattta gaaaattgta ttcaactttt ttgacgctac ctgttgaaac
      181 accttgagag atataatgaa tggtacctct ataaataatg gtgactcagc caccccgccc
      241 tcatcacctg gctctacgac agtggtaaaa tatgaaaaat cttcctgcct tttctgcaat
      301 gaatggttcg attcacaaac atttacggag cacttaattc actgtggcca agtgctggaa
      361 cagtgtccca atacctgcaa tgtgtttgtg ccacgcattc gcatgcgtgc tcatctcaaa
      421 gagtgtccac gtaataaacg tcgcagtact agtttagagc gtgtcgatca ccagatcgat
      481 actcgtgttc aggtgttgga aaatgaaatc aacaccttgc gttcagtgtt aaatgaggaa
      541 attcgacagc gtttacattt aatcaccgat gtgggtaatc tacgtaaaca gaatcaaatc
      601 atcgatgatt ggcaacactc cacaaatcaa aatgtgaaag ctctacagtt acgtttggat
      661 gaggaaaaca atcaaaggac atttgaggtg gaacaatgtc agcaggattt tcgttgcagc
      721 tttgatacca tacaggccct taaaactgaa atacgacatg agattgacga tctggagaag
      781 catatcaatc aaatgtcttt ggatcttacc caacatcaga atcatttaaa tgataatatt
      841 atgaagttag aggagacggt attgttgcat gagaagatta atagagataa attcatagaa
      901 gttgaaaact ttttacaagc catcaatgtg gatttaaata ctaaactttc ttctggcaat
      961 gatgggggca aatatgccgc cctggatgtc gaggtgaaga gcatgaaaca tatggtctgc
     1021 gaaaccgagg aacgttgtga caaattggaa accttggttg gtcagattga tcgcagttta
     1081 catcatacca tgcagctggt gaatgattgt gaaaatcata ttgccaccca acaacgtttg
     1141 accagttata ttaactgcag aggccatttg gtatggagaa tcaaaaattt ctccaaaaag
     1201 ctggaagagg ccagacaata cgataccata ctccatagtg ccatgttttc caataagcct
     1261 tttggctatg ctttaagact ggacatttac cttaacggca aaggtacttg gaagggacgc
     1321 aatatgattg cctgtttaaa tgtcatagcc ggcgaatatg atccactact gccttggccc
     1381 tgccgcctgc aagccgatgt cataattcgt gatcaaactc taaaccaact ggaacccgat
     1441 gattatgtga agacggtgtt ggtgcgcaag aagagtgatg attacataca gaccaaacag
     1501 ttctttcaca tatcccatag cattttaacc cagagtagat atgtgaaaaa tgattccatt
     1561 tttgtggagg tgaagattgt caagtgatag caagttttgt attagtt