Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243187 462 bp mRNA linear INV 02-SEP-2023 (LOC106081310), mRNA. ACCESSION XM_013243187 VERSION XM_013243187.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243187.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..462 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..462 /gene="LOC106081310" /note="uncharacterized LOC106081310; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106081310" CDS 126..377 /gene="LOC106081310" /codon_start=1 /product="uncharacterized protein LOC106081310" /protein_id="XP_013098641.1" /db_xref="GeneID:106081310" /translation="MCNPKFRMRHNHFYKSLKQICFGIVLSLSASGACYVLHSLPRKE KYANFYTNYDPMSSFTRMKEGGYLDSCPPTSKGHNFKQK" misc_feature 135..338 /gene="LOC106081310" /note="Cytochrome c oxidase subunit VIc; Region: COX6C; pfam02937" /db_xref="CDD:460756" polyA_site 462 /gene="LOC106081310" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatccattca attcacattt tccagttggt gagagcattg atattaaaag gattttgaag 61 gacttcttta aagacgaaat aaataccaaa ccatttcata tcgaattgcg gcaatcagga 121 ttaccatgtg caatcccaag tttcgcatgc gtcataatca tttctacaaa tctttaaagc 181 aaatttgctt tggcattgtc ctatctttga gtgcatccgg ggcctgttat gtcctccata 241 gtttgccgcg taaagagaaa tatgccaact tttatacaaa ttatgatccc atgtcttcgt 301 ttactcgcat gaaggaaggt ggctatttag attcatgtcc tccaacttcg aagggacata 361 atttcaagca aaaataatga ccatatacat atgagatttc aggatgcttt aaaaattatc 421 tggctttttt gttctaaata aaactcctga tttgtaaatc aa