Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106081310


LOCUS       XM_013243187             462 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081310), mRNA.
ACCESSION   XM_013243187
VERSION     XM_013243187.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243187.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..462
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..462
                     /gene="LOC106081310"
                     /note="uncharacterized LOC106081310; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106081310"
     CDS             126..377
                     /gene="LOC106081310"
                     /codon_start=1
                     /product="uncharacterized protein LOC106081310"
                     /protein_id="XP_013098641.1"
                     /db_xref="GeneID:106081310"
                     /translation="MCNPKFRMRHNHFYKSLKQICFGIVLSLSASGACYVLHSLPRKE
                     KYANFYTNYDPMSSFTRMKEGGYLDSCPPTSKGHNFKQK"
     misc_feature    135..338
                     /gene="LOC106081310"
                     /note="Cytochrome c oxidase subunit VIc; Region: COX6C;
                     pfam02937"
                     /db_xref="CDD:460756"
     polyA_site      462
                     /gene="LOC106081310"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatccattca attcacattt tccagttggt gagagcattg atattaaaag gattttgaag
       61 gacttcttta aagacgaaat aaataccaaa ccatttcata tcgaattgcg gcaatcagga
      121 ttaccatgtg caatcccaag tttcgcatgc gtcataatca tttctacaaa tctttaaagc
      181 aaatttgctt tggcattgtc ctatctttga gtgcatccgg ggcctgttat gtcctccata
      241 gtttgccgcg taaagagaaa tatgccaact tttatacaaa ttatgatccc atgtcttcgt
      301 ttactcgcat gaaggaaggt ggctatttag attcatgtcc tccaacttcg aagggacata
      361 atttcaagca aaaataatga ccatatacat atgagatttc aggatgcttt aaaaattatc
      421 tggctttttt gttctaaata aaactcctga tttgtaaatc aa