Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans nucleoside diphosphate kinase 6


LOCUS       XM_013243182             737 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081305), mRNA.
ACCESSION   XM_013243182
VERSION     XM_013243182.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243182.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..737
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..737
                     /gene="LOC106081305"
                     /note="nucleoside diphosphate kinase 6; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106081305"
     CDS             164..616
                     /gene="LOC106081305"
                     /codon_start=1
                     /product="nucleoside diphosphate kinase 6"
                     /protein_id="XP_013098636.2"
                     /db_xref="GeneID:106081305"
                     /translation="MEITLALIKPHVVRNTLALRSLLAMIKANFTVLESKQIHITKHL
                     SEKFYAEHQGKFFYNRLTTFMGSGPSYALILQSDGGISKWRSLMGPTKVYKAIYTNPD
                     CIRALYGLSDTRNACHGSDSPESALREIDILFPEFNITDALKAIENKS"
     polyA_site      737
                     /gene="LOC106081305"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttctccaaaa agctacaaca aattagtcaa aacaaagaag cacagcataa agttttaata
       61 cgaagatgta tatccgaaat acaaattatc ctgttattta gttttaagcc caatatagag
      121 gtctatgtct ggttaaaaat tcgaaaaact atttgcctac gatatggaaa taacattggc
      181 tctcataaaa ccgcatgtgg tgcgtaacac acttgccttg cgttcactat tggcaatgat
      241 aaaagccaat tttactgtgc tggaatccaa acaaatacac attacgaaac acctttcgga
      301 aaaattttat gcagagcacc agggaaaatt cttttataat cgccttacaa catttatggg
      361 aagtggacct tcgtatgcat tgatacttca atcagatggt ggaatttcaa agtggcgttc
      421 cttgatgggc cctaccaaag tttataaggc tatttatacg aatcccgatt gtatacgtgc
      481 cttatatgga ttatcggata ctcgcaatgc ctgtcatggt tccgatagcc cagaatcagc
      541 tttaagggaa attgacatcc tatttccaga gttcaatata acggatgctt tgaaggccat
      601 tgaaaacaag agctgactga atagttgaaa ggattttatt gaatatttgt ttgttgttat
      661 tataaaggga aaattcgata gaaatggaat gaacgtaaga catttcttga aatatggcaa
      721 tgcaactacc tcctaaa