Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243182 737 bp mRNA linear INV 02-SEP-2023 (LOC106081305), mRNA. ACCESSION XM_013243182 VERSION XM_013243182.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243182.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..737 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..737 /gene="LOC106081305" /note="nucleoside diphosphate kinase 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106081305" CDS 164..616 /gene="LOC106081305" /codon_start=1 /product="nucleoside diphosphate kinase 6" /protein_id="XP_013098636.2" /db_xref="GeneID:106081305" /translation="MEITLALIKPHVVRNTLALRSLLAMIKANFTVLESKQIHITKHL SEKFYAEHQGKFFYNRLTTFMGSGPSYALILQSDGGISKWRSLMGPTKVYKAIYTNPD CIRALYGLSDTRNACHGSDSPESALREIDILFPEFNITDALKAIENKS" polyA_site 737 /gene="LOC106081305" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttctccaaaa agctacaaca aattagtcaa aacaaagaag cacagcataa agttttaata 61 cgaagatgta tatccgaaat acaaattatc ctgttattta gttttaagcc caatatagag 121 gtctatgtct ggttaaaaat tcgaaaaact atttgcctac gatatggaaa taacattggc 181 tctcataaaa ccgcatgtgg tgcgtaacac acttgccttg cgttcactat tggcaatgat 241 aaaagccaat tttactgtgc tggaatccaa acaaatacac attacgaaac acctttcgga 301 aaaattttat gcagagcacc agggaaaatt cttttataat cgccttacaa catttatggg 361 aagtggacct tcgtatgcat tgatacttca atcagatggt ggaatttcaa agtggcgttc 421 cttgatgggc cctaccaaag tttataaggc tatttatacg aatcccgatt gtatacgtgc 481 cttatatgga ttatcggata ctcgcaatgc ctgtcatggt tccgatagcc cagaatcagc 541 tttaagggaa attgacatcc tatttccaga gttcaatata acggatgctt tgaaggccat 601 tgaaaacaag agctgactga atagttgaaa ggattttatt gaatatttgt ttgttgttat 661 tataaaggga aaattcgata gaaatggaat gaacgtaaga catttcttga aatatggcaa 721 tgcaactacc tcctaaa