Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106081200),


LOCUS       XM_013243004             524 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013243004
VERSION     XM_013243004.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..524
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..524
                     /gene="LOC106081200"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106081200"
     CDS             31..513
                     /gene="LOC106081200"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013098458.1"
                     /db_xref="GeneID:106081200"
                     /translation="MERIACFILLVTYFVVQSNGLTEANYYTSPMNKIYYIEPQNKYN
                     WFGSLTECTRMNMSIITVDSAEKTKDLNDVINTNFKDVEKPLLYIGGSDMADNGKYVW
                     HSTGNEFVYTNWAEYEPNNFEDDEHCVHIGLYNDGTWNDVKCSLKLGFICEVNKNEPQ
                     "
     misc_feature    133..492
                     /gene="LOC106081200"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(406..408,418..420,424..426,442..444,448..459,
                     466..474)
                     /gene="LOC106081200"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     polyA_site      524
                     /gene="LOC106081200"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caaacctgat ttagtcattt ctggggaaca atggagcgta tagcgtgttt catacttttg
       61 gttacctatt tcgtggtaca gagtaatgga ttaactgagg ccaactatta cacatcgccc
      121 atgaataaga tatactacat agagccacaa aataagtata attggtttgg ttctctaaca
      181 gaatgcactc gcatgaatat gagcattata actgtagaca gtgctgaaaa gaccaaggat
      241 ctcaatgatg tcataaatac caattttaaa gatgtagaaa aacccttgct ttatataggt
      301 ggcagtgata tggctgataa tggcaaatac gtttggcact caacgggcaa tgagtttgtt
      361 tataccaatt gggctgaata tgaacccaat aatttcgaag atgatgagca ttgtgtgcat
      421 ataggtctgt acaatgatgg cacctggaat gatgtgaaat gctccttaaa gcttggcttt
      481 atttgtgaag taaataaaaa tgagccacaa taattgaaaa ataa