Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243004 524 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013243004 VERSION XM_013243004.1 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..524 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..524 /gene="LOC106081200" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106081200" CDS 31..513 /gene="LOC106081200" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013098458.1" /db_xref="GeneID:106081200" /translation="MERIACFILLVTYFVVQSNGLTEANYYTSPMNKIYYIEPQNKYN WFGSLTECTRMNMSIITVDSAEKTKDLNDVINTNFKDVEKPLLYIGGSDMADNGKYVW HSTGNEFVYTNWAEYEPNNFEDDEHCVHIGLYNDGTWNDVKCSLKLGFICEVNKNEPQ " misc_feature 133..492 /gene="LOC106081200" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(406..408,418..420,424..426,442..444,448..459, 466..474) /gene="LOC106081200" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" polyA_site 524 /gene="LOC106081200" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caaacctgat ttagtcattt ctggggaaca atggagcgta tagcgtgttt catacttttg 61 gttacctatt tcgtggtaca gagtaatgga ttaactgagg ccaactatta cacatcgccc 121 atgaataaga tatactacat agagccacaa aataagtata attggtttgg ttctctaaca 181 gaatgcactc gcatgaatat gagcattata actgtagaca gtgctgaaaa gaccaaggat 241 ctcaatgatg tcataaatac caattttaaa gatgtagaaa aacccttgct ttatataggt 301 ggcagtgata tggctgataa tggcaaatac gtttggcact caacgggcaa tgagtttgtt 361 tataccaatt gggctgaata tgaacccaat aatttcgaag atgatgagca ttgtgtgcat 421 ataggtctgt acaatgatgg cacctggaat gatgtgaaat gctccttaaa gcttggcttt 481 atttgtgaag taaataaaaa tgagccacaa taattgaaaa ataa