Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243003 643 bp mRNA linear INV 02-SEP-2023 (LOC106081199), mRNA. ACCESSION XM_013243003 VERSION XM_013243003.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243003.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..643 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..643 /gene="LOC106081199" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106081199" CDS 41..568 /gene="LOC106081199" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013098457.1" /db_xref="GeneID:106081199" /translation="MKGSTVLGIVVISVLLWNFALAADDDDKDPNIFTTENFKYFIET KQKYNWSEAATECENKKMNLVSIDTKAKSDDVKIILNEAFLNNKKRIPSMFIGANDLV EFRDFIWLPKGDVFTYTNWEKNEPNNYRKLNERCVHLGYHGDEKWNDINCARKLGFIC EQLLNPEGGEAVPKV" misc_feature 152..526 /gene="LOC106081199" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(440..442,452..454,458..460,476..478,482..493, 500..508) /gene="LOC106081199" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" polyA_site 643 /gene="LOC106081199" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcataccgca ttctgaaaca ttcagtgtgt aaacagcaac atgaagggat caacggttct 61 gggcatcgta gttatcagtg ttttattgtg gaattttgca ctagctgccg atgacgacga 121 taaagatcca aatattttca ccacagaaaa tttcaaatat ttcatagaga caaaacaaaa 181 gtacaactgg tcggaggcgg caacagaatg tgagaataaa aaaatgaatc tggtctcgat 241 tgacaccaaa gccaaatcag atgatgtgaa gataattctt aatgaagctt tccttaataa 301 caaaaagcga ataccatcaa tgttcattgg agcaaatgac ttggtcgaat ttcgtgactt 361 catatggcta cccaagggtg atgttttcac ttacaccaac tgggaaaaga acgaaccaaa 421 taattatcga aaactaaatg agcgatgcgt tcatctgggc taccacggag atgaaaaatg 481 gaacgatata aactgtgcac ggaaactggg ttttatatgt gaacaactat taaatcccga 541 aggtggtgaa gcggtgccaa aggtgtagtt ttaaatttaa tacctaagtg aatgtaatgc 601 aagatttgat tttaataaat ctaagactta aaaaaatccc aga