Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013243003             643 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081199), mRNA.
ACCESSION   XM_013243003
VERSION     XM_013243003.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243003.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..643
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..643
                     /gene="LOC106081199"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106081199"
     CDS             41..568
                     /gene="LOC106081199"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013098457.1"
                     /db_xref="GeneID:106081199"
                     /translation="MKGSTVLGIVVISVLLWNFALAADDDDKDPNIFTTENFKYFIET
                     KQKYNWSEAATECENKKMNLVSIDTKAKSDDVKIILNEAFLNNKKRIPSMFIGANDLV
                     EFRDFIWLPKGDVFTYTNWEKNEPNNYRKLNERCVHLGYHGDEKWNDINCARKLGFIC
                     EQLLNPEGGEAVPKV"
     misc_feature    152..526
                     /gene="LOC106081199"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(440..442,452..454,458..460,476..478,482..493,
                     500..508)
                     /gene="LOC106081199"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     polyA_site      643
                     /gene="LOC106081199"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcataccgca ttctgaaaca ttcagtgtgt aaacagcaac atgaagggat caacggttct
       61 gggcatcgta gttatcagtg ttttattgtg gaattttgca ctagctgccg atgacgacga
      121 taaagatcca aatattttca ccacagaaaa tttcaaatat ttcatagaga caaaacaaaa
      181 gtacaactgg tcggaggcgg caacagaatg tgagaataaa aaaatgaatc tggtctcgat
      241 tgacaccaaa gccaaatcag atgatgtgaa gataattctt aatgaagctt tccttaataa
      301 caaaaagcga ataccatcaa tgttcattgg agcaaatgac ttggtcgaat ttcgtgactt
      361 catatggcta cccaagggtg atgttttcac ttacaccaac tgggaaaaga acgaaccaaa
      421 taattatcga aaactaaatg agcgatgcgt tcatctgggc taccacggag atgaaaaatg
      481 gaacgatata aactgtgcac ggaaactggg ttttatatgt gaacaactat taaatcccga
      541 aggtggtgaa gcggtgccaa aggtgtagtt ttaaatttaa tacctaagtg aatgtaatgc
      601 aagatttgat tttaataaat ctaagactta aaaaaatccc aga