Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106081197


LOCUS       XM_013243002             503 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106081197), mRNA.
ACCESSION   XM_013243002
VERSION     XM_013243002.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013243002.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..503
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..503
                     /gene="LOC106081197"
                     /note="uncharacterized LOC106081197; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106081197"
     CDS             49..279
                     /gene="LOC106081197"
                     /codon_start=1
                     /product="uncharacterized protein LOC106081197"
                     /protein_id="XP_013098456.1"
                     /db_xref="GeneID:106081197"
                     /translation="MWKKIVVLLAIWAFLVGTVMSFPQQQGGNSWPPPPPNGARPSGP
                     PPNGPPPSGMPPRGPPPNGAPPPSTTAATSTS"
     polyA_site      503
                     /gene="LOC106081197"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tataaaaatg cctagtgatg acagttgact attgcagttg ataacaaaat gtggaaaaag
       61 attgtagtgc tcttagccat ttgggcattt ttagtgggaa ctgttatgag ttttccccaa
      121 caacaaggtg gcaattcctg gcctccacca cctcccaatg gggccagacc tagtggtcca
      181 ccaccaaatg gtcctcctcc cagcggcatg ccacctagag gacctcctcc aaatggcgct
      241 ccaccacctt ctaccacagc tgctacctcg accagttaaa cacatccggc ttaatacctc
      301 tcacttgcta ttgaaatgtc caggaaataa attcatgtta cctacctatg gattatgttg
      361 ccttttcccc cactctacca aatcgtcctt taatatatcc ttgaatcaag tgtggtaatg
      421 tttgtatatg tttagcattt gttttcgttt ttttgtttag tttagtttgt cgtctaaata
      481 caaaaatgat ataaccaaac taa