Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013243002 503 bp mRNA linear INV 02-SEP-2023 (LOC106081197), mRNA. ACCESSION XM_013243002 VERSION XM_013243002.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013243002.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..503 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..503 /gene="LOC106081197" /note="uncharacterized LOC106081197; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106081197" CDS 49..279 /gene="LOC106081197" /codon_start=1 /product="uncharacterized protein LOC106081197" /protein_id="XP_013098456.1" /db_xref="GeneID:106081197" /translation="MWKKIVVLLAIWAFLVGTVMSFPQQQGGNSWPPPPPNGARPSGP PPNGPPPSGMPPRGPPPNGAPPPSTTAATSTS" polyA_site 503 /gene="LOC106081197" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tataaaaatg cctagtgatg acagttgact attgcagttg ataacaaaat gtggaaaaag 61 attgtagtgc tcttagccat ttgggcattt ttagtgggaa ctgttatgag ttttccccaa 121 caacaaggtg gcaattcctg gcctccacca cctcccaatg gggccagacc tagtggtcca 181 ccaccaaatg gtcctcctcc cagcggcatg ccacctagag gacctcctcc aaatggcgct 241 ccaccacctt ctaccacagc tgctacctcg accagttaaa cacatccggc ttaatacctc 301 tcacttgcta ttgaaatgtc caggaaataa attcatgtta cctacctatg gattatgttg 361 ccttttcccc cactctacca aatcgtcctt taatatatcc ttgaatcaag tgtggtaatg 421 tttgtatatg tttagcattt gttttcgttt ttttgtttag tttagtttgt cgtctaaata 481 caaaaatgat ataaccaaac taa