Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242472 722 bp mRNA linear INV 02-SEP-2023 (LOC106080872), mRNA. ACCESSION XM_013242472 VERSION XM_013242472.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242472.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..722 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..722 /gene="LOC106080872" /note="uncharacterized LOC106080872; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106080872" CDS 134..640 /gene="LOC106080872" /codon_start=1 /product="uncharacterized protein LOC106080872" /protein_id="XP_013097926.1" /db_xref="GeneID:106080872" /translation="MDNNNQILVDTEPETSLEHDGEEGILAITRNATKSLYNITFENF DQHESVEFKNYESRLQKEIKDWKSLFQTAYNDLKKSEQKHPIIDKSILPQEKREYLEK APCLQSFIRESLAFRRQAYEFLEIEYAEAMELAAYLEEECEHRLLQVKTEILTENLAS YSRRSSSG" polyA_site 722 /gene="LOC106080872" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tacttaatgt accttgaatc aaatcactgg caactctggc agccagctgg taaatttggc 61 gagatattta tgatttaaat tgctatttgc acgcataaac ttatccgaaa aaaattaatt 121 tcaattcata aaaatggata ataataatca aatattggtt gacaccgaac cagaaaccag 181 cttagaacat gatggggaag aaggaatttt ggcaattaca aggaatgcaa caaagagctt 241 gtacaatata acttttgaaa atttcgacca acacgagagt gtggaattta agaactacga 301 aagccgtctc caaaaggaaa ttaaagactg gaagtcatta tttcaaactg cttataatga 361 tctgaagaaa tcagaacaga agcatcccat aatagacaag tcgatattgc ctcaagagaa 421 aagagaatac ttggaaaagg cgccttgcct acaaagcttc attagagaat ctttggcgtt 481 tcggcgacag gcgtacgaat ttctagaaat tgaatacgca gaggctatgg aattggctgc 541 atatcttgag gaagaatgcg agcaccgtct tctccaggta aagacagaaa tattaacaga 601 aaatctagca tcttattcaa gaagatcaag ttctggctga cacaaaatgg agtttttaat 661 gagtttcaat aaaaaagtaa attattttca aaaatgtgtg gtttactaat aactaatgca 721 aa