Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106080872


LOCUS       XM_013242472             722 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080872), mRNA.
ACCESSION   XM_013242472
VERSION     XM_013242472.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242472.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..722
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..722
                     /gene="LOC106080872"
                     /note="uncharacterized LOC106080872; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106080872"
     CDS             134..640
                     /gene="LOC106080872"
                     /codon_start=1
                     /product="uncharacterized protein LOC106080872"
                     /protein_id="XP_013097926.1"
                     /db_xref="GeneID:106080872"
                     /translation="MDNNNQILVDTEPETSLEHDGEEGILAITRNATKSLYNITFENF
                     DQHESVEFKNYESRLQKEIKDWKSLFQTAYNDLKKSEQKHPIIDKSILPQEKREYLEK
                     APCLQSFIRESLAFRRQAYEFLEIEYAEAMELAAYLEEECEHRLLQVKTEILTENLAS
                     YSRRSSSG"
     polyA_site      722
                     /gene="LOC106080872"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tacttaatgt accttgaatc aaatcactgg caactctggc agccagctgg taaatttggc
       61 gagatattta tgatttaaat tgctatttgc acgcataaac ttatccgaaa aaaattaatt
      121 tcaattcata aaaatggata ataataatca aatattggtt gacaccgaac cagaaaccag
      181 cttagaacat gatggggaag aaggaatttt ggcaattaca aggaatgcaa caaagagctt
      241 gtacaatata acttttgaaa atttcgacca acacgagagt gtggaattta agaactacga
      301 aagccgtctc caaaaggaaa ttaaagactg gaagtcatta tttcaaactg cttataatga
      361 tctgaagaaa tcagaacaga agcatcccat aatagacaag tcgatattgc ctcaagagaa
      421 aagagaatac ttggaaaagg cgccttgcct acaaagcttc attagagaat ctttggcgtt
      481 tcggcgacag gcgtacgaat ttctagaaat tgaatacgca gaggctatgg aattggctgc
      541 atatcttgag gaagaatgcg agcaccgtct tctccaggta aagacagaaa tattaacaga
      601 aaatctagca tcttattcaa gaagatcaag ttctggctga cacaaaatgg agtttttaat
      661 gagtttcaat aaaaaagtaa attattttca aaaatgtgtg gtttactaat aactaatgca
      721 aa