Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-signal (LOC106080854), transcript


LOCUS       XM_013242453            1253 bp    mRNA    linear   INV 02-SEP-2023
            variant X3, mRNA.
ACCESSION   XM_013242453
VERSION     XM_013242453.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242453.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1253
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1253
                     /gene="LOC106080854"
                     /note="C-signal; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106080854"
     CDS             307..1050
                     /gene="LOC106080854"
                     /codon_start=1
                     /product="C-signal isoform X2"
                     /protein_id="XP_013097907.1"
                     /db_xref="GeneID:106080854"
                     /translation="MNSILITGCNRGLGLGLVKALVKLPKPPQHLFATCRNKDQAKEL
                     QDLAAEHPCIHIIEIDLNNFEAYDDLVKQIDDTTQGCGLNVLFNNAAIAYNEPNLDAV
                     KADQMMNTFKTNSVVPVMLTIACLPLIKKASEANNSLEMGLERAAIINMSSSLGSIST
                     NTTGGFFTYRCSKAALNAATKSFSIELLPDKILCVALHPGWVRTEMGGPNAPMEINCT
                     TEEIVNTVMKFNKSHHGGFYQHDGVNLPW"
     misc_feature    316..1047
                     /gene="LOC106080854"
                     /note="carbonyl reductase sniffer-like, classical (c)
                     SDRs; Region: carb_red_sniffer_like_SDR_c; cd05325"
                     /db_xref="CDD:187586"
     misc_feature    order(328..330,334..345,412..414,484..489,571..582,
                     643..645,757..765,811..813,823..825,898..912,916..918,
                     922..927)
                     /gene="LOC106080854"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187586"
     misc_feature    order(487..489,505..507,625..627,640..642,649..657,
                     664..666,673..678,769..789,805..807,814..819,826..831,
                     838..843,847..852,859..864,1042..1047)
                     /gene="LOC106080854"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187586"
     misc_feature    order(646..648,763..765,811..813,823..825)
                     /gene="LOC106080854"
                     /note="active site"
                     /db_xref="CDD:187586"
     polyA_site      1253
                     /gene="LOC106080854"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gagaatgtgc aaaaagcaac aattgttaat aaccccgaga aacatgttct tttagtttcc
       61 attgaattcg aaattttata ttgtgtaaat tagaaagcac ttaataacaa ataagagacg
      121 acaggaaggg gaatacgcga aaaataaata cttgaataca tcgatttttt tatcagatta
      181 ttcgtcgtgg aacagcacac ggcacttaca agatcgagaa tttgccacca agatcttaat
      241 ttggaataaa ttaaactagc gtatcggaga gacctatatc gtcgttgcct tctttctacc
      301 tacaaaatga attcaatttt gataaccgga tgtaatcgtg gtctgggttt gggtttggtt
      361 aaagctttgg tgaaattgcc caaacccccg caacatttgt tcgccacatg ccgcaacaag
      421 gaccaagcca aggaacttca agacttagca gcggaacatc cttgcattca tataatagag
      481 attgatttga acaatttcga ggcttatgat gacttagtta agcaaattga cgacaccacg
      541 caaggttgcg gccttaatgt cctcttcaat aatgctgcaa ttgcttataa tgaaccaaat
      601 cttgatgcag ttaaggccga tcaaatgatg aatactttta aaaccaattc ggttgtacct
      661 gttatgttga ccatagcgtg tttgcctcta attaaaaaag cgtccgaagc taacaactcc
      721 cttgagatgg gtctggaacg agcagcaatt attaatatga gtagcagttt gggttctata
      781 agcactaata cgaccggtgg tttctttact tatcgctgtt ctaaagctgc cttgaatgct
      841 gctaccaagt cgttcagtat tgaattatta ccagataaaa ttctttgtgt tgctttacat
      901 cccggttggg tccgtactga gatgggagga ccaaatgctc ccatggaaat aaattgcaca
      961 acagaggaaa tagtaaacac tgttatgaag tttaataaaa gccatcatgg tggattttat
     1021 cagcatgatg gcgttaatct accatggtag acacattgta ttcttgattt gataaaaaac
     1081 agcttttacc tcattgttgt attgcatttt aatgttttaa attttatatt ataaaaaaaa
     1141 agtctataat attatctaaa aaagttgtct tttcagtcag gtttaagctt ttaaaacgat
     1201 acctagtgtg caaagtaaaa tattgcccaa taaatgaaag gggaaccaca tga