Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-signal (LOC106080854), transcript


LOCUS       XM_013242451            1008 bp    mRNA    linear   INV 02-SEP-2023
            variant X5, mRNA.
ACCESSION   XM_013242451
VERSION     XM_013242451.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242451.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1008
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1008
                     /gene="LOC106080854"
                     /note="C-signal; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 9 Proteins"
                     /db_xref="GeneID:106080854"
     CDS             216..959
                     /gene="LOC106080854"
                     /codon_start=1
                     /product="C-signal isoform X1"
                     /protein_id="XP_013097905.2"
                     /db_xref="GeneID:106080854"
                     /translation="MNSILITGCNRGLGLGLVKALVKLPKPPQHLFATCRNKDQAKDL
                     LNLAAQNSNIHVMEIDLRDYYSHDNLVKQIDDITGGYGLNLLFNNAGISPKSTRINMT
                     KAEDIMNTLETNTVVPIMLAKACLPLLKKASKSQESLDLCVQRAAIINMSSMLGSIEM
                     NETGGLYAYRTSKAALNAATKSLSIDLLPHNILCVALHPGWVRTEMGGKNAPLEVDPT
                     TAEIIDTIMKFKAKHNGGFYQYNGDKLPW"
     polyA_site      1008
                     /gene="LOC106080854"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acgcaaattc gttgcaattg ttctcctaac gtttgaggtg gcggcagagt tagctacaac
       61 tgtcggtttg gtggaacgta caaatattat tcgtcgtgga acagcacacg gcacttacaa
      121 gatcgagaat ttgccaccaa gatcttaatt tggaataaat taaactagcg tatcggagag
      181 acctatatcg tcgttgcctt ctttctacct acaaaatgaa ttcaattttg ataaccggat
      241 gtaatcgtgg tctgggtttg ggtttggtta aagctttggt gaaattgccc aaacccccgc
      301 aacatttgtt cgccacatgc cgcaacaagg accaagccaa ggaccttcta aatttggctg
      361 cccaaaattc caatattcat gtaatggaaa ttgatttgcg cgactattat tcccacgaca
      421 atttagttaa acaaatagat gacatcacag gtggctatgg tctcaatcta ctcttcaata
      481 atgccggaat ttctccaaaa tcgactagga taaatatgac taaggcagag gatataatga
      541 atacattaga aaccaacaca gttgtgccta ttatgttggc taaagcctgt ttaccattac
      601 ttaaaaaagc ctccaaatca caggaatctc tcgatttgtg tgtacagagg gctgctatta
      661 taaatatgag ctctatgttg ggatcaatcg aaatgaatga aactggtggc ctctatgcat
      721 atcggacttc caaagctgct ttaaatgctg caacaaaatc gctgagtatt gatttgttgc
      781 cgcataacat tctttgtgtt gccttacatc ccggctgggt gcgcacagaa atgggtggaa
      841 agaacgctcc attggaagtt gatcccacaa ctgcggaaat cattgatact atcatgaagt
      901 tcaaagcgaa gcataatgga ggtttctatc agtacaatgg tgacaaattg ccatggtagt
      961 taagactaag tgatataaat gaataaaatg aaattgcttg caactaaa