Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans C-signal (LOC106080854), transcript


LOCUS       XM_013242447            1085 bp    mRNA    linear   INV 02-SEP-2023
            variant X1, mRNA.
ACCESSION   XM_013242447
VERSION     XM_013242447.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242447.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1085
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1085
                     /gene="LOC106080854"
                     /note="C-signal; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 9 Proteins"
                     /db_xref="GeneID:106080854"
     CDS             293..1036
                     /gene="LOC106080854"
                     /codon_start=1
                     /product="C-signal isoform X1"
                     /protein_id="XP_013097901.2"
                     /db_xref="GeneID:106080854"
                     /translation="MNSILITGCNRGLGLGLVKALVKLPKPPQHLFATCRNKDQAKDL
                     LNLAAQNSNIHVMEIDLRDYYSHDNLVKQIDDITGGYGLNLLFNNAGISPKSTRINMT
                     KAEDIMNTLETNTVVPIMLAKACLPLLKKASKSQESLDLCVQRAAIINMSSMLGSIEM
                     NETGGLYAYRTSKAALNAATKSLSIDLLPHNILCVALHPGWVRTEMGGKNAPLEVDPT
                     TAEIIDTIMKFKAKHNGGFYQYNGDKLPW"
     polyA_site      1085
                     /gene="LOC106080854"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agcaacaatt gttaataacc ccgagaaaca tgttctttta gtttccattg aattcgaaat
       61 tttatattgt gtaaattaga aagcacttaa taacaaataa gagacgacag gaaggggaat
      121 acgcgaaaaa taaatacttg aatacatcga tttttttatc agattattcg tcgtggaaca
      181 gcacacggca cttacaagat cgagaatttg ccaccaagat cttaatttgg aataaattaa
      241 actagcgtat cggagagacc tatatcgtcg ttgccttctt tctacctaca aaatgaattc
      301 aattttgata accggatgta atcgtggtct gggtttgggt ttggttaaag ctttggtgaa
      361 attgcccaaa cccccgcaac atttgttcgc cacatgccgc aacaaggacc aagccaagga
      421 ccttctaaat ttggctgccc aaaattccaa tattcatgta atggaaattg atttgcgcga
      481 ctattattcc cacgacaatt tagttaaaca aatagatgac atcacaggtg gctatggtct
      541 caatctactc ttcaataatg ccggaatttc tccaaaatcg actaggataa atatgactaa
      601 ggcagaggat ataatgaata cattagaaac caacacagtt gtgcctatta tgttggctaa
      661 agcctgttta ccattactta aaaaagcctc caaatcacag gaatctctcg atttgtgtgt
      721 acagagggct gctattataa atatgagctc tatgttggga tcaatcgaaa tgaatgaaac
      781 tggtggcctc tatgcatatc ggacttccaa agctgcttta aatgctgcaa caaaatcgct
      841 gagtattgat ttgttgccgc ataacattct ttgtgttgcc ttacatcccg gctgggtgcg
      901 cacagaaatg ggtggaaaga acgctccatt ggaagttgat cccacaactg cggaaatcat
      961 tgatactatc atgaagttca aagcgaagca taatggaggt ttctatcagt acaatggtga
     1021 caaattgcca tggtagttaa gactaagtga tataaatgaa taaaatgaaa ttgcttgcaa
     1081 ctaaa