Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242447 1085 bp mRNA linear INV 02-SEP-2023 variant X1, mRNA. ACCESSION XM_013242447 VERSION XM_013242447.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242447.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1085 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1085 /gene="LOC106080854" /note="C-signal; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106080854" CDS 293..1036 /gene="LOC106080854" /codon_start=1 /product="C-signal isoform X1" /protein_id="XP_013097901.2" /db_xref="GeneID:106080854" /translation="MNSILITGCNRGLGLGLVKALVKLPKPPQHLFATCRNKDQAKDL LNLAAQNSNIHVMEIDLRDYYSHDNLVKQIDDITGGYGLNLLFNNAGISPKSTRINMT KAEDIMNTLETNTVVPIMLAKACLPLLKKASKSQESLDLCVQRAAIINMSSMLGSIEM NETGGLYAYRTSKAALNAATKSLSIDLLPHNILCVALHPGWVRTEMGGKNAPLEVDPT TAEIIDTIMKFKAKHNGGFYQYNGDKLPW" polyA_site 1085 /gene="LOC106080854" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agcaacaatt gttaataacc ccgagaaaca tgttctttta gtttccattg aattcgaaat 61 tttatattgt gtaaattaga aagcacttaa taacaaataa gagacgacag gaaggggaat 121 acgcgaaaaa taaatacttg aatacatcga tttttttatc agattattcg tcgtggaaca 181 gcacacggca cttacaagat cgagaatttg ccaccaagat cttaatttgg aataaattaa 241 actagcgtat cggagagacc tatatcgtcg ttgccttctt tctacctaca aaatgaattc 301 aattttgata accggatgta atcgtggtct gggtttgggt ttggttaaag ctttggtgaa 361 attgcccaaa cccccgcaac atttgttcgc cacatgccgc aacaaggacc aagccaagga 421 ccttctaaat ttggctgccc aaaattccaa tattcatgta atggaaattg atttgcgcga 481 ctattattcc cacgacaatt tagttaaaca aatagatgac atcacaggtg gctatggtct 541 caatctactc ttcaataatg ccggaatttc tccaaaatcg actaggataa atatgactaa 601 ggcagaggat ataatgaata cattagaaac caacacagtt gtgcctatta tgttggctaa 661 agcctgttta ccattactta aaaaagcctc caaatcacag gaatctctcg atttgtgtgt 721 acagagggct gctattataa atatgagctc tatgttggga tcaatcgaaa tgaatgaaac 781 tggtggcctc tatgcatatc ggacttccaa agctgcttta aatgctgcaa caaaatcgct 841 gagtattgat ttgttgccgc ataacattct ttgtgttgcc ttacatcccg gctgggtgcg 901 cacagaaatg ggtggaaaga acgctccatt ggaagttgat cccacaactg cggaaatcat 961 tgatactatc atgaagttca aagcgaagca taatggaggt ttctatcagt acaatggtga 1021 caaattgcca tggtagttaa gactaagtga tataaatgaa taaaatgaaa ttgcttgcaa 1081 ctaaa