PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1

LOCUS       XM_013242433             844 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080845), mRNA.
ACCESSION   XM_013242433
VERSION     XM_013242433.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242433.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..844
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..844
                     /gene="LOC106080845"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 9 Proteins"
                     /db_xref="GeneID:106080845"
     CDS             1..816
                     /gene="LOC106080845"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_013097887.2"
                     /db_xref="GeneID:106080845"
                     /translation="MNMLQYLIFATLFIGCITTTNYCSSTLCKAGKKHIACGHNGKFA
                     STCPKNAAMVSFTTGMKDFIVDRHNAKRNLIAGGTVANHKAACRMATMQWDQELANLV
                     GLNVRQCKMSHDSCRNTDSFKHSGQNLAWMKYSGSLNAKKLLDKAVNMWYNEVKYSKM
                     EYINSFPDSTTILKKIGHFTVMVADRNIRVGCAASSYTQKGDKKKTFLIGCNYATSNI
                     LGMPTYVSCAKAGTTCKKGKNTKYTNLCSSSEIYNVGWTNQKNSWVPFQFYSN"
ORIGIN      
        1 atgaatatgc ttcagtattt gattttcgct acattattca ttggctgtat aacaacaaca
       61 aactactgtt cttcaacact ttgtaaggct ggcaaaaaac acatagcttg tggccacaat
      121 ggaaaattcg cctccacctg cccgaaaaat gctgctatgg tcagctttac caccggcatg
      181 aaagatttca tcgtagaccg tcacaatgca aagcggaatt tgattgccgg cggaactgtg
      241 gctaatcata aggcagcttg tcgcatggct accatgcagt gggaccagga attagccaac
      301 ttggtagggc tcaatgtacg tcagtgtaaa atgagtcatg atagctgccg aaatacggat
      361 tccttcaaac attcaggtca aaatttggcc tggatgaagt atagtggcag tttgaacgca
      421 aagaaacttt tggataaggc cgtcaacatg tggtataatg aagttaaata cagcaaaatg
      481 gaatatataa attcttttcc cgatagcact accattttaa agaaaatcgg tcattttacc
      541 gttatggtag cagaccgaaa catacgtgtt ggctgtgcgg cttcttccta tacacaaaaa
      601 ggagataaga aaaagacgtt tcttattggc tgcaactatg ccacatcaaa tattttgggt
      661 atgccaactt atgtcagttg tgcaaaggcc ggcacaacat gtaaaaaggg caaaaatacg
      721 aaatatacca atttgtgttc atcgtcagaa atctacaacg tcggttggac caaccaaaaa
      781 aacagctggg tgccattcca attttattcc aactaaaaac tttttagtag acaacattga
      841 attt