Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1


LOCUS       XM_013242432             949 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080844), mRNA.
ACCESSION   XM_013242432
VERSION     XM_013242432.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242432.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..949
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..949
                     /gene="LOC106080844"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:106080844"
     CDS             19..780
                     /gene="LOC106080844"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_013097886.1"
                     /db_xref="GeneID:106080844"
                     /translation="METFKGFLFTAFVIALAHTEDYCDKKLCPVGTHIGCRHDGKFSP
                     SCPKDVSLVKIDKSLKDYIVNGFNEKRNFIAGGGNHIHKSACRMATMQWDYELAKLAE
                     LNVRQCEMKQEACHNTMAYPMSGQNLAWKTYSNEPDYPALVESVVQMWYDEVNHSKME
                     YIEKYPDHDTGAVIAHFTAMVADRNFRLGCAASTYSMAGETYMAFLMACNFAFTNKIG
                     EPIYTDCTTPAEKCTTGKNPKYPNLCSISEEYDVS"
     misc_feature    196..654
                     /gene="LOC106080844"
                     /note="Eukaryotic CAP (cysteine-rich secretory proteins,
                     antigen 5, and pathogenesis-related 1 proteins) domain
                     proteins; Region: CAP_euk; cd05380"
                     /db_xref="CDD:349399"
     polyA_site      949
                     /gene="LOC106080844"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caaccgtctt ccaccaacat ggaaacattt aaggggtttt tgtttacggc tttcgtcata
       61 gcattggccc acacagagga ctattgtgat aaaaaacttt gtccagtggg aactcatatt
      121 ggatgtcgtc atgatggtaa attcagtcca tcttgcccta aagacgtgtc actagttaaa
      181 atcgataaat cgcttaaaga ctacatagtt aatggattta atgaaaaaag aaatttcata
      241 gctggaggtg gaaatcatat acataagtct gcatgccgca tggccactat gcagtgggat
      301 tatgaattgg ccaaattagc tgaattgaat gtccgacaat gtgaaatgaa gcaggaagcg
      361 tgtcacaata ctatggccta tccaatgtct gggcaaaatt tagcttggaa aacctatagc
      421 aatgaacccg attacccagc cttagtcgaa agtgttgttc aaatgtggta tgatgaagtc
      481 aatcacagta aaatggagta catagaaaaa tatcctgatc atgatactgg agcagttatt
      541 gctcacttca cagccatggt ggcggatcgc aactttcgcc tagggtgtgc cgcatcgacg
      601 tattccatgg ctggcgaaac ctacatggct tttcttatgg cctgcaattt tgcatttacg
      661 aacaaaattg gtgaaccgat ttacaccgat tgcactactc cggctgagaa atgtacaact
      721 ggaaagaatc caaaatatcc taatttgtgc tcaatctctg aagaatatga tgtcagttaa
      781 ctcttaccat taggtaaact tttccattgt taaacataga agcaagttaa actacagaag
      841 gtttggctgg gtcaaactac aatacattca taggttatta aatttaggat taattgaaaa
      901 ccctctaatt ttttatatac aaatacaagt gctttttaaa agcaataca