Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242432 949 bp mRNA linear INV 02-SEP-2023 (LOC106080844), mRNA. ACCESSION XM_013242432 VERSION XM_013242432.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242432.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..949 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..949 /gene="LOC106080844" /note="antigen 5 like allergen Cul n 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106080844" CDS 19..780 /gene="LOC106080844" /codon_start=1 /product="antigen 5 like allergen Cul n 1" /protein_id="XP_013097886.1" /db_xref="GeneID:106080844" /translation="METFKGFLFTAFVIALAHTEDYCDKKLCPVGTHIGCRHDGKFSP SCPKDVSLVKIDKSLKDYIVNGFNEKRNFIAGGGNHIHKSACRMATMQWDYELAKLAE LNVRQCEMKQEACHNTMAYPMSGQNLAWKTYSNEPDYPALVESVVQMWYDEVNHSKME YIEKYPDHDTGAVIAHFTAMVADRNFRLGCAASTYSMAGETYMAFLMACNFAFTNKIG EPIYTDCTTPAEKCTTGKNPKYPNLCSISEEYDVS" misc_feature 196..654 /gene="LOC106080844" /note="Eukaryotic CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain proteins; Region: CAP_euk; cd05380" /db_xref="CDD:349399" polyA_site 949 /gene="LOC106080844" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caaccgtctt ccaccaacat ggaaacattt aaggggtttt tgtttacggc tttcgtcata 61 gcattggccc acacagagga ctattgtgat aaaaaacttt gtccagtggg aactcatatt 121 ggatgtcgtc atgatggtaa attcagtcca tcttgcccta aagacgtgtc actagttaaa 181 atcgataaat cgcttaaaga ctacatagtt aatggattta atgaaaaaag aaatttcata 241 gctggaggtg gaaatcatat acataagtct gcatgccgca tggccactat gcagtgggat 301 tatgaattgg ccaaattagc tgaattgaat gtccgacaat gtgaaatgaa gcaggaagcg 361 tgtcacaata ctatggccta tccaatgtct gggcaaaatt tagcttggaa aacctatagc 421 aatgaacccg attacccagc cttagtcgaa agtgttgttc aaatgtggta tgatgaagtc 481 aatcacagta aaatggagta catagaaaaa tatcctgatc atgatactgg agcagttatt 541 gctcacttca cagccatggt ggcggatcgc aactttcgcc tagggtgtgc cgcatcgacg 601 tattccatgg ctggcgaaac ctacatggct tttcttatgg cctgcaattt tgcatttacg 661 aacaaaattg gtgaaccgat ttacaccgat tgcactactc cggctgagaa atgtacaact 721 ggaaagaatc caaaatatcc taatttgtgc tcaatctctg aagaatatga tgtcagttaa 781 ctcttaccat taggtaaact tttccattgt taaacataga agcaagttaa actacagaag 841 gtttggctgg gtcaaactac aatacattca taggttatta aatttaggat taattgaaaa 901 ccctctaatt ttttatatac aaatacaagt gctttttaaa agcaataca