Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242427 952 bp mRNA linear INV 02-SEP-2023 (LOC106080840), mRNA. ACCESSION XM_013242427 VERSION XM_013242427.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242427.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..952 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..952 /gene="LOC106080840" /note="antigen 5 like allergen Cul n 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106080840" CDS 102..890 /gene="LOC106080840" /codon_start=1 /product="antigen 5 like allergen Cul n 1" /protein_id="XP_013097881.2" /db_xref="GeneID:106080840" /translation="MLTHQYKFVFSTITMIILNLVQAKDYCNPSLCRKDIKHIGCKNN GHFSSTCPSDARMVNMDGKLKTTLVKAHNEKRNFIAGGGDRRHSPACNMATIEWDDEL ASLAALNVRQCRIVHDKCHNTDLFKFSGQNLYLSSFTSADNDADMLRKAVESWFKENE NSRMQFINKYPGNDDAPTIGHFTVMMADRNTRVGCAAATYTEAGKFFKWYLLACNYAT TNMKNQSIYSACRSPASGCKTRTNPAYPNLCTPAEKYDVNKMRS" polyA_site 952 /gene="LOC106080840" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgaacaat ccattgctct aataaaagat gctcttcgag accatcatta atatcagtcg 61 gatatcagtt atttctatag cagacaacgt tttaatcaac aatgctaacc caccagtata 121 aatttgtctt ctcaacaatt accatgatca ttttaaactt ggtgcaggca aaggattatt 181 gtaatccttc tctctgtcgt aaggatataa agcatatagg atgcaaaaac aatggtcact 241 tttcctccac ttgtccatct gatgccagaa tggttaatat ggatggaaaa cttaagacta 301 cacttgtcaa agcccacaat gaaaaaagaa actttatagc tggaggcggt gaccgtagac 361 attcccctgc ttgcaacatg gccaccatag aatgggatga tgaattagct tccttggcag 421 ctcttaatgt gcgtcagtgc cgcattgttc atgacaaatg ccacaatacc gatctgttta 481 agttttccgg ccagaatttg tatttgtcca gctttacgag cgctgacaat gatgcagata 541 tgttacgcaa agctgtggaa tcctggttca aagaaaatga aaacagtcgt atgcagttca 601 tcaacaaata ccctggcaat gacgatgcac caacaattgg ccattttacc gttatgatgg 661 ctgatcgaaa tacacgtgtg ggatgtgcag ctgccacata taccgaagct gggaaatttt 721 tcaaatggta tctcttggcc tgcaattatg ctacaaccaa tatgaaaaat caatccatat 781 atagcgcatg tcgcagtcca gcctctggct gtaaaactcg tacaaatcct gcttacccaa 841 atttgtgcac accagccgaa aaatatgacg tcaataagat gaggagctaa attccaaaaa 901 tgagtgtccc aaataaataa aaaaaaaata aactaaacaa gtaaaatggc aa