Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1


LOCUS       XM_013242427             952 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080840), mRNA.
ACCESSION   XM_013242427
VERSION     XM_013242427.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242427.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..952
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..952
                     /gene="LOC106080840"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106080840"
     CDS             102..890
                     /gene="LOC106080840"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_013097881.2"
                     /db_xref="GeneID:106080840"
                     /translation="MLTHQYKFVFSTITMIILNLVQAKDYCNPSLCRKDIKHIGCKNN
                     GHFSSTCPSDARMVNMDGKLKTTLVKAHNEKRNFIAGGGDRRHSPACNMATIEWDDEL
                     ASLAALNVRQCRIVHDKCHNTDLFKFSGQNLYLSSFTSADNDADMLRKAVESWFKENE
                     NSRMQFINKYPGNDDAPTIGHFTVMMADRNTRVGCAAATYTEAGKFFKWYLLACNYAT
                     TNMKNQSIYSACRSPASGCKTRTNPAYPNLCTPAEKYDVNKMRS"
     polyA_site      952
                     /gene="LOC106080840"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgaacaat ccattgctct aataaaagat gctcttcgag accatcatta atatcagtcg
       61 gatatcagtt atttctatag cagacaacgt tttaatcaac aatgctaacc caccagtata
      121 aatttgtctt ctcaacaatt accatgatca ttttaaactt ggtgcaggca aaggattatt
      181 gtaatccttc tctctgtcgt aaggatataa agcatatagg atgcaaaaac aatggtcact
      241 tttcctccac ttgtccatct gatgccagaa tggttaatat ggatggaaaa cttaagacta
      301 cacttgtcaa agcccacaat gaaaaaagaa actttatagc tggaggcggt gaccgtagac
      361 attcccctgc ttgcaacatg gccaccatag aatgggatga tgaattagct tccttggcag
      421 ctcttaatgt gcgtcagtgc cgcattgttc atgacaaatg ccacaatacc gatctgttta
      481 agttttccgg ccagaatttg tatttgtcca gctttacgag cgctgacaat gatgcagata
      541 tgttacgcaa agctgtggaa tcctggttca aagaaaatga aaacagtcgt atgcagttca
      601 tcaacaaata ccctggcaat gacgatgcac caacaattgg ccattttacc gttatgatgg
      661 ctgatcgaaa tacacgtgtg ggatgtgcag ctgccacata taccgaagct gggaaatttt
      721 tcaaatggta tctcttggcc tgcaattatg ctacaaccaa tatgaaaaat caatccatat
      781 atagcgcatg tcgcagtcca gcctctggct gtaaaactcg tacaaatcct gcttacccaa
      841 atttgtgcac accagccgaa aaatatgacg tcaataagat gaggagctaa attccaaaaa
      901 tgagtgtccc aaataaataa aaaaaaaata aactaaacaa gtaaaatggc aa