Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013242425 910 bp mRNA linear INV 02-SEP-2023 (LOC106080837), transcript variant X3, mRNA. ACCESSION XM_013242425 VERSION XM_013242425.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013242425.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..910 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..910 /gene="LOC106080837" /note="glycine-rich selenoprotein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106080837" CDS 121..432 /gene="LOC106080837" /codon_start=1 /product="glycine-rich selenoprotein" /protein_id="XP_013097879.2" /db_xref="GeneID:106080837" /translation="MVYIDRDGRVLEKRPWDMARIMGIFTGIWLVVVQFFQTLIAPFN QENRGGNRRSDGGGWGSGGGYGGGGGGGGSGGGGNGGLRPNRRIGRVTNSMDCNIPGG G" polyA_site 910 /gene="LOC106080837" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccacgtcatt tttaaaatcc acaacgcaaa atttagttat attcttcgat ttttcaggaa 61 ataaacgctt gcagaagaaa gttctagttt ttgcataatt tatgcggtcg ccattataaa 121 atggtttaca tagatcgcga tggtcgagtt ttggagaaac gaccttggga catggcccgc 181 ataatgggca ttttcacagg gatatggctt gttgttgtac aattcttcca aacactcatt 241 gcgccattta accaagagaa ccgtggtgga aaccgtcgca gtgatggtgg tggatgggga 301 tccggtggtg gttatggcgg cggaggtggt ggtggtggta gtggcggtgg gggaaatggt 361 ggccttcgtc ccaaccgtcg tattggccgt gtaactaatt caatggattg taatataccc 421 ggaggcggat gagcacggta aagtgtccag gcattttgta cgagtaatgc tgcttgtgca 481 attcacgatt aattggctat ttttatcggt tatcacatga tatcgatgaa tctccagttc 541 aacttttcac tggaatgaac tgcactgaat agaactaaaa taaaacatgg caaatattac 601 tcgcctggac acagctgacc ccgttaacca atccctaaca gcatcaacat catacaaagt 661 tttttttttt ttttttaata tgctcacaaa ttcacttttc ggtacaaagt tacctttatg 721 acgacccact tgtaaactca acccagaggg aagtgagtct gatctttaac aagagtgatt 781 tttgtgcata taaactttgt gggattgaat tttagtaaaa tttttataaa tattgaaata 841 catatatttt tgtgtattat actcatttat ttttgatcaa aatacaacgc atcttataca 901 aacaaactta