Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glycine-rich selenoprotein


LOCUS       XM_013242425             910 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080837), transcript variant X3, mRNA.
ACCESSION   XM_013242425
VERSION     XM_013242425.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242425.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..910
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..910
                     /gene="LOC106080837"
                     /note="glycine-rich selenoprotein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106080837"
     CDS             121..432
                     /gene="LOC106080837"
                     /codon_start=1
                     /product="glycine-rich selenoprotein"
                     /protein_id="XP_013097879.2"
                     /db_xref="GeneID:106080837"
                     /translation="MVYIDRDGRVLEKRPWDMARIMGIFTGIWLVVVQFFQTLIAPFN
                     QENRGGNRRSDGGGWGSGGGYGGGGGGGGSGGGGNGGLRPNRRIGRVTNSMDCNIPGG
                     G"
     polyA_site      910
                     /gene="LOC106080837"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccacgtcatt tttaaaatcc acaacgcaaa atttagttat attcttcgat ttttcaggaa
       61 ataaacgctt gcagaagaaa gttctagttt ttgcataatt tatgcggtcg ccattataaa
      121 atggtttaca tagatcgcga tggtcgagtt ttggagaaac gaccttggga catggcccgc
      181 ataatgggca ttttcacagg gatatggctt gttgttgtac aattcttcca aacactcatt
      241 gcgccattta accaagagaa ccgtggtgga aaccgtcgca gtgatggtgg tggatgggga
      301 tccggtggtg gttatggcgg cggaggtggt ggtggtggta gtggcggtgg gggaaatggt
      361 ggccttcgtc ccaaccgtcg tattggccgt gtaactaatt caatggattg taatataccc
      421 ggaggcggat gagcacggta aagtgtccag gcattttgta cgagtaatgc tgcttgtgca
      481 attcacgatt aattggctat ttttatcggt tatcacatga tatcgatgaa tctccagttc
      541 aacttttcac tggaatgaac tgcactgaat agaactaaaa taaaacatgg caaatattac
      601 tcgcctggac acagctgacc ccgttaacca atccctaaca gcatcaacat catacaaagt
      661 tttttttttt ttttttaata tgctcacaaa ttcacttttc ggtacaaagt tacctttatg
      721 acgacccact tgtaaactca acccagaggg aagtgagtct gatctttaac aagagtgatt
      781 tttgtgcata taaactttgt gggattgaat tttagtaaaa tttttataaa tattgaaata
      841 catatatttt tgtgtattat actcatttat ttttgatcaa aatacaacgc atcttataca
      901 aacaaactta