Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like


LOCUS       XM_013242422             855 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106080835), mRNA.
ACCESSION   XM_013242422
VERSION     XM_013242422.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013242422.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..855
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..855
                     /gene="LOC106080835"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 14 Proteins"
                     /db_xref="GeneID:106080835"
     CDS             79..855
                     /gene="LOC106080835"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013097876.2"
                     /db_xref="GeneID:106080835"
                     /translation="MNLLQLILFTVLCISGYVTATNYCSSTICSGGKTHIACGHNGRF
                     DATCPANAAMINFNATFRANIVNRHNTKRNLIAGGTVANHKAACRMASMQWTAELAKL
                     AALNVRQCIMNHDACRNTDDFKYSGQNLARIPFWGKVNTRKMLFTAIDLWYSEVKNSK
                     MSNINKFPATYDHTKEIGHFTVMVAERNIRVGCAAATYKKQGDTSKTFLMACNYATTN
                     MIDRPIYASCARPAAKCKKGKNVKFPNLCKVAEVYDVNTW"
ORIGIN      
        1 agtgggaggc atcagtgttc agacagctat tttttcttct ttatttcttc tttacgacga
       61 catctattgg gagtggaaat gaacttgctc cagttgatac tattcacggt cctgtgtatt
      121 agcggctacg ttacggctac aaattactgc tcgagtacca tttgtagtgg tggcaaaacc
      181 cacatagcct gtggtcataa cggcagattt gatgccacat gtccggccaa cgcagccatg
      241 ataaacttta acgccacttt tagagccaac attgtaaata ggcataatac gaagagaaac
      301 ttaattgcag gtggtactgt ggccaatcac aaggcagcct gccgcatggc aagcatgcaa
      361 tggactgcag aactggccaa actggcagct ttgaatgtgc gccagtgcat aatgaatcat
      421 gacgcctgcc gaaatacaga tgatttcaaa tattctggcc agaatttggc ccgcattcca
      481 ttctggggaa aagtgaacac aaggaaaatg ttattcaccg ctatagatct gtggtacagc
      541 gaggtcaaaa atagtaaaat gtccaacatc aataaatttc cggctaccta tgatcacacc
      601 aaggaaattg gccattttac ggttatggtg gctgaacgca atattcgagt gggctgtgcc
      661 gcagccacat ataaaaaaca aggagacaca tcgaaaacat ttttaatggc ctgtaactat
      721 gccaccacaa acatgataga taggcccatt tatgccagtt gtgcgagacc cgcggctaaa
      781 tgtaaaaagg gcaagaatgt gaaattccca aatttgtgca aggtcgccga agtatacgat
      841 gttaatacat ggtga